(data stored in ACNUC7421 zone)

EMBL: CP001069.PE70

CP001069.PE70        Location/Qualifiers
FT   CDS_pept        80373..81155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3832"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: rso:RS02008 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3832"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28946"
FT                   /db_xref="GOA:B2UH95"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH95"
FT                   /protein_id="ACD28946.1"
FT                   /translation="MATPAMLTGHHAVVTGAGRGIGAAIAAQLAAHGATLTLMGRNADV
FT                   LHATAKTLPDSARAQVVTCDVTDEASVSAAFESARAGLGPISILVNNAGQAESASFAKT
FT                   TLDQWQRMLAVNLTGTFLCTQAALPDVQASGRGRIVNIASTAGQRGYAYVSAYVAAKHG
FT                   VIGLTRSLALELAARGVTVNAVCPGYTETDIVRESIDRIVARTGRSEEEARAELVKGNP
FT                   QGRLITPDEVANAVVWLCSDGASSITGQAISVSGGEVM"
     atggcgacac ctgcaatgct caccgggcac cacgccgtcg ttactggcgc agggcgcggg        60
     attggcgctg cgattgccgc gcaactcgcg gcgcatggcg ccacgctcac gctgatgggt       120
     cgcaacgccg atgtgctgca cgccactgcc aagacgttgc ctgacagcgc ccgcgcgcaa       180
     gtcgtgacgt gcgatgtgac cgacgaggcg agcgtgtcgg cggcgttcga atctgcacgc       240
     gcggggcttg gccccatctc catcctcgtc aacaacgcgg gccaggccga gagcgcatcg       300
     tttgccaaga ccacgctcga ccaatggcag cgcatgctgg ccgtgaacct gacgggcacg       360
     ttcctgtgca cgcaggcggc gctgcccgat gtgcaggcgt cgggccgcgg ccgcatcgtg       420
     aacattgcca gcacggcggg gcagcgcggt tatgcgtatg tgtcggcgta tgtggccgcc       480
     aagcatggcg tcattggcct aacgcgctcg ctggcgctgg agctggcggc gcgcggcgtc       540
     accgtcaacg cagtctgccc cggctatacg gaaaccgaca tcgtgcgcga gagcatcgac       600
     cgcatcgtcg cccgcaccgg ccgcagcgaa gaagaagcgc gggccgagct ggtgaagggc       660
     aacccgcagg gccggctgat cacgccagac gaagtggcga atgccgtggt gtggctgtgc       720
     tccgatggcg cgtcgtcgat cacgggccag gccatctcgg tatccggcgg ggaggtgatg       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page