(data stored in SCRATCH zone)

EMBL: CP001069.PE71

CP001069.PE71        Location/Qualifiers
FT   CDS_pept        81152..81736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3833"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: rso:RS02009
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3833"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28947"
FT                   /db_xref="GOA:B2UH96"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH96"
FT                   /protein_id="ACD28947.1"
FT                   /translation="MSTERTRRKTALATRASGHHAVVQALGDQHIGLEARAHVDDHMDV
FT                   KIWLRLLACSTQIEQQIRQRLRTRFNTTLPRFDYLAQLDRHPDGLRMNVLSRYLMVTGG
FT                   NVTGLTDQLEKEGLVKREADPDDRRSFRVLLTDAGRRHFAEMAAEHERWLIEMFDGLGI
FT                   ANKDALYAQLGHLRVHLAQREQELDAREDQP"
     gtgagcaccg aacgcacccg gcgcaaaacc gcactcgcta cgcgcgcctc cggccaccac        60
     gccgtcgtgc aggcgctggg cgaccaacat atcggcctgg aagcccgcgc gcatgtggac       120
     gaccacatgg acgtgaagat ctggctgcgc ctgttggcct gcagtacgca gatcgaacag       180
     cagatccgcc agcgcctgcg cacgcgtttc aacaccacgt tgccgcgctt cgactatctg       240
     gcacaactcg acaggcatcc ggacggcctg cgcatgaacg tgctgtcgcg ctacctgatg       300
     gtgaccggcg gcaacgtcac cggcctgacc gaccagctgg agaaggaagg gcttgtcaaa       360
     cgcgaggcgg atccggatga tcgccggtcc tttcgcgtgc tgctgaccga cgccggccgc       420
     cgccactttg ccgagatggc cgccgagcac gaacgctggc tgatcgagat gttcgacggc       480
     cttggcattg ccaacaaaga cgcgctctat gcgcagctcg gccacctgcg cgttcatctc       540
     gcgcagcgcg agcaagagct ggacgcccgc gaagatcaac cctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page