(data stored in ACNUC7421 zone)

EMBL: CP001069.PE73

CP001069.PE73        Location/Qualifiers
FT   CDS_pept        82616..83791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3835"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: rso:RS02011
FT                   probable acyl-CoA dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3835"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28949"
FT                   /db_xref="GOA:B2UH98"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH98"
FT                   /protein_id="ACD28949.1"
FT                   /translation="MSDKDYLQWPFFDDKHRQLEAELDAWATKHIAHDHGPDVDAECRA
FT                   LVKLLGQGGWLRHAVGGTAHGGAGETIDTRAICLIRETLARHSGLADFAFAMQGLGSGA
FT                   ISLHGTPEQRERYLTKVAHGEAISAFALSEPDAGSDVAAMASAAREDGNDYVLDGEKTW
FT                   ISNGGIADFYVVFARTGEAPGSRGISAFIVEAGTPGFEIAERINVIAPHPLARLRFTNC
FT                   RIPASQRVGAAGEGFKVAMRTLDVFRTSVAAAALGFARRALDEALARATTRKMFSGVLA
FT                   DFQLTQAKLAQMATAIDSAALLTYRAAWQRDQGRNVTREAAMAKLTATENAQQVIDAAV
FT                   QMWGGLGVVSEQPVERLYREIRSLRIYEGATEVQQLIIARELLRAAAPAKS"
     atgagcgaca aagactatct gcaatggccc ttctttgacg acaagcaccg ccagctcgaa        60
     gccgaactcg acgcctgggc cacgaagcac atcgcgcacg accacggccc ggatgtggat       120
     gccgagtgcc gtgcgttggt gaagctgctc ggccaaggcg gctggttgcg ccacgcggtt       180
     ggcggcacgg cgcacggcgg tgcgggcgag accatcgaca cgcgcgccat ctgcctgatc       240
     cgcgaaacgt tggcgcgcca ttccggcctg gccgactttg cctttgcgat gcaggggctg       300
     gggtcgggcg ccatctcgtt gcacggcacg ccggagcagc gcgagcgcta tctgacgaag       360
     gtcgcgcacg gcgaggccat ctctgcattt gcgctgtccg aacccgatgc tggctccgat       420
     gtggccgcca tggccagcgc cgcgcgtgaa gacggcaacg actatgtgct cgacggcgag       480
     aagacgtgga tttccaatgg cggcatcgca gacttctacg tcgtgtttgc ccgcaccggc       540
     gaagcgccgg gctcgcgcgg catcagcgcg ttcattgtcg aggccggtac gccgggcttt       600
     gagattgcgg agcgcatcaa cgtgattgca ccgcacccgc tcgcgcgcct gcgctttacc       660
     aactgccgca ttccggccag ccagcgcgtg ggcgcggcgg gcgagggctt caaggtggcg       720
     atgcgcacgc tcgatgtgtt ccgtacctcg gtggccgcag ccgcgctggg ctttgcacgc       780
     cgcgcgctgg acgaagcgct ggcgcgcgcc accacccgca agatgttcag cggcgtgctg       840
     gccgatttcc aactcacgca ggccaagctc gcgcagatgg ccaccgccat tgacagcgcc       900
     gcgctgctga cgtaccgcgc cgcgtggcag cgcgaccagg gccgcaacgt gacgcgcgaa       960
     gccgccatgg ccaagttgac cgccaccgag aacgcgcagc aggtgatcga cgccgccgtg      1020
     cagatgtggg gtggcctggg cgtggtgagc gagcagcctg tcgagcgcct gtaccgcgag      1080
     atccgctcgc tgcggatcta cgaaggcgcg acggaagtgc agcaactcat catcgcgcgc      1140
     gaactgctgc gtgcggcggc gcccgccaag tcctga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page