(data stored in ACNUC7421 zone)

EMBL: CP001069.PE74

CP001069.PE74        Location/Qualifiers
FT   CDS_pept        83828..85444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3836"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rso:RS02012 probable acetyl-coenzyme A synthetase
FT                   (acetate--CoA ligase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3836"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28950"
FT                   /db_xref="GOA:B2UH99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH99"
FT                   /protein_id="ACD28950.1"
FT                   /translation="MPSAHIDTFARDRLPPAELQPVYRFDLPALQFPPQLNCATELLDR
FT                   RVAAGEGGRLCIQATGIRWTYADLQAHANRIANVLVNEMGVVPGNRVLLRSPNSPMLAA
FT                   CWFAVMKVGAIAVTTMPLLRAKELGQILGKGEIGFALCDARLVDELRDAVTQAAKPVQL
FT                   LCFHDDTPEGLEAAMVRQPATFTNVDTAADDTCLLAFTSGTTGVPKATMHFHRDILAIC
FT                   ACWPPHVLQPRADDIFIGSPPMAFTFGLGGLLLFPMSVGASTVLLEKASPNDLVDGIRT
FT                   FGATVLFTAPTTYRIIAARGDELRATPLRRCVSAGEALPVATRTLWKDATGIELIDGIG
FT                   ATEMLHIFISAADADVRPGATGKAVPGYVAQVVDDAGNPVPPGTVGRLAVQGPTGCRYL
FT                   ADDRQRAYVRNGWNLTGDAYVMDEEGYFHYHSRTDDMIISSGYNIAAPEVEDALMQHPA
FT                   VAECGVIGEPDEERGQIVKAFVVLHPGHSAGPEMVKTLQDFVKQTVAPYKYPRAIEFRT
FT                   SLPRSEVGKLLRYRLREHDKS"
     atgcccagcg cccatatcga caccttcgcc cgcgaccggc tgccgccggc ggagctgcaa        60
     ccggtgtatc gcttcgacct gccagcgctg cagtttccgc cgcagctcaa ctgcgccacc       120
     gaactgctcg accgccgtgt tgccgcgggc gagggcggcc gcctttgcat ccaggcgacc       180
     ggcatccgct ggacgtacgc cgacctgcag gcgcacgcca accgcatcgc caacgtgctg       240
     gtcaatgaga tgggcgtcgt gccgggcaac cgcgtgctgc tgcgctcgcc caacagcccg       300
     atgctcgccg cctgctggtt tgccgtgatg aaagtgggtg cgattgcggt gaccaccatg       360
     ccgctgctgc gcgccaaaga gctggggcag attctgggca agggcgagat tggcttcgcg       420
     ctgtgcgatg cgcggctcgt cgacgagcta cgcgatgccg tgacgcaagc ggccaagccc       480
     gtgcaactgc tgtgctttca cgatgacacg ccggaagggc tggaggcggc catggtgcgc       540
     cagccggcca ccttcaccaa cgtcgatacg gcggcggacg acacgtgcct gctcgccttc       600
     acgtcgggca cgacgggcgt gccgaaagcg acgatgcatt ttcatcgcga catcctcgcc       660
     atttgcgcgt gctggccgcc gcacgtgctg cagccgcgcg cggacgacat cttcatcggc       720
     agcccgccga tggcgttcac gttcgggctc ggcggtctgc tgctgtttcc gatgagcgtg       780
     ggtgcatcga cggtgctgct ggaaaaggca tcgccgaacg atctggtcga tggcatccgc       840
     acgtttggcg cgacggtgct gtttacggcg cccaccacgt accgcatcat cgcggcgcgc       900
     ggagacgagt tgcgtgccac gccgctgcgc cgctgtgtgt cggccggcga ggcgctgccg       960
     gtggccacgc gcacgctgtg gaaggacgcc accggcatcg agctgattga cggcattggc      1020
     gcgaccgaga tgctgcatat ctttatctcc gctgccgacg ccgacgtgcg cccaggcgcc      1080
     accggcaagg ccgtccccgg ctatgtcgca caagtcgtgg atgatgcagg caaccctgtg      1140
     ccgccgggca cggtgggccg cctggcggtg caaggcccga ccggctgccg ctacctggcc      1200
     gatgaccgcc agcgcgccta cgtgcgcaac ggctggaacc tcacggggga tgcctatgtg      1260
     atggacgagg aaggctactt ccactaccac tcgcgcaccg acgacatgat catctcgtcc      1320
     ggctacaaca ttgccgcgcc cgaggtggaa gacgcgctga tgcagcatcc ggccgtggcc      1380
     gagtgtggcg tgatcggcga gcccgacgaa gagcgcgggc agatcgtcaa ggccttcgtt      1440
     gtattgcacc cgggccactc ggcggggccg gagatggtca agacgctgca ggacttcgtg      1500
     aagcagaccg tggccccgta caagtatccg cgcgccatcg agttccgtac gagcctgccg      1560
     cgcagtgaag tcggcaagct gctgcgctac cgcctgcgcg aacacgacaa atcatga         1617
//

If you have problems or comments...

PBIL Back to PBIL home page