(data stored in ACNUC7421 zone)

EMBL: CP001069.PE75

CP001069.PE75        Location/Qualifiers
FT   CDS_pept        85441..85872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3837"
FT                   /product="putative 4-hydroxybenzoyl-CoA thioesterase
FT                   protein"
FT                   /note="KEGG: rso:RS02013 putative 4-hydroxybenzoyl-CoA
FT                   thioesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3837"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28951"
FT                   /db_xref="GOA:B2UHA0"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA0"
FT                   /protein_id="ACD28951.1"
FT                   /translation="MSDYHFERAARIRFAHCDPAGIVYFPQYLVLFNGLVEDWFTDGLG
FT                   VSYAQMLGPRRIGLPIVKLHCEFSAISRMGDDVQFKLKLERLGNASLTLALDCWAGNEQ
FT                   RVQSQQVLVFTDLNTHRAIAVPPDVRQAIEASVQQSQSN"
     atgagtgact accacttcga gcgtgccgcc cgcatccgct ttgcacactg cgacccggcc        60
     ggcatcgtct actttccgca gtaccttgta ctgttcaatg gcctggtcga agactggttt       120
     accgacggcc tgggcgtttc gtatgcgcag atgctgggcc cgcgccgcat cggcctgccc       180
     atcgtcaagc tgcattgcga gttcagcgcc atcagccgca tgggcgacga cgtgcagttc       240
     aagttgaagc tggagcggct gggcaatgcg tcgctcacgc tggcgctcga ttgctgggcg       300
     ggcaatgaac agcgcgtgca gtcacagcag gtgctggtgt ttactgatct caatacgcat       360
     cgcgcgatcg cggtgccgcc cgatgtgcgg caggcgatcg aggcgagcgt tcaacagtcg       420
     caatcgaact ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page