(data stored in SCRATCH zone)

EMBL: CP001069.PE76

CP001069.PE76        Location/Qualifiers
FT   CDS_pept        85886..86278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3838"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rso:RS02014
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3838"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28952"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA1"
FT                   /protein_id="ACD28952.1"
FT                   /translation="MEVLLPPNWPRPKGYANGVSARGRMVFVAGMIGWDAQGVFHTDDL
FT                   AGQVRQALQNIVEVLAAGDAKPEHIVRMTWYVTDKKAYVAAYPEIGQAFRELIGSFSIA
FT                   MTAVEVAALVEDRAKVEIEVTAVVPD"
     atggaagtac tcctccctcc caactggccg cgtccgaagg gctatgccaa cggtgtgtcc        60
     gcacgcgggc gcatggtgtt cgtggccggc atgatcggct gggatgcgca gggcgtgttc       120
     cacacggatg acctggccgg tcaggtccgc caggcgctgc agaacatcgt cgaggtgctg       180
     gccgccggcg acgccaagcc cgagcacatc gtgcgcatga cgtggtacgt gaccgacaag       240
     aaggcctacg tggcggccta tcccgagatc ggccaggcgt tccgcgaact gatcggcagc       300
     ttcagcattg cgatgacggc agtggaagtg gccgcgctgg tggaagaccg cgcaaaggtg       360
     gaaatcgagg tgacggcggt ggtgccggac tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page