(data stored in SCRATCH zone)

EMBL: CP001069.PE8

CP001069.PE8         Location/Qualifiers
FT   CDS_pept        6310..7407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3768"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   rso:RS02227 probable sigma-54 interacting transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3768"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28884"
FT                   /db_xref="GOA:B2UH33"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH33"
FT                   /protein_id="ACD28884.1"
FT                   /translation="MSLSEAFADEHATTAGRLPCPPSLTDMAEFDDVDPAAAQAIAIAE
FT                   PDFGHLYGRSPVMRALYNQIGKVSGTLATVLIIGESGTGKELIARTVHDMSPRADQAFI
FT                   AVNCGAISPNLIESELFGHEKGSFTGATQRHTGYFEHACGGTIFLDEITEMPVEMQVKL
FT                   LRVLETGVFMRVGGTEPIQTRARIIAATNRNLMEAVADGAFREDLMYRLAVVPLHVPPL
FT                   RDRGDDIEELALHFLAQFNAAHQTDKVFSRTALTVLHNHGWPGNVRELRNAVQRGYILG
FT                   EKTVDLDNPISSPRGPTRPTVKEGVLNLSVGVTLAEAQRAMILATLEHFHGDKRQAAKT
FT                   LGVSLKTLYNRLDLYQGAAAAGMAA"
     atgtccttga gcgaagcctt cgcagacgag cacgccacga cggccgggcg actgccctgc        60
     ccccccagcc tgaccgatat ggcggagttt gacgacgtcg accccgccgc cgcccaggcc       120
     atcgccattg cggagcccga cttcggccat ctgtacggcc gctcgcccgt catgcgcgcg       180
     ctgtacaacc agatcggcaa ggtctcaggc acgctggcca ccgtgctgat catcggtgaa       240
     tcgggcaccg gcaaagaact catcgcgcgt acggtgcacg acatgagccc gcgcgcggac       300
     caggcattca ttgccgtgaa ctgcggcgcg atctcgccca acctgatcga gtcggaactc       360
     ttcggccacg agaaaggcag cttcaccggc gcaacccagc ggcataccgg ctatttcgag       420
     catgcctgcg gcgggaccat cttcctggac gaaatcaccg aaatgccggt cgagatgcag       480
     gtcaagctgc tgcgcgtgct ggagaccggc gtgttcatgc gcgtgggcgg caccgagccg       540
     atccagacac gcgcgcgcat catcgcggcg accaaccgta acctgatgga agcggtggcg       600
     gacggcgcct ttcgcgaaga cctgatgtac cgcctggccg tcgtgccctt gcatgtgccg       660
     ccgctgcgtg accgcggcga cgacatcgaa gaacttgccc tgcatttcct ggcgcaattc       720
     aacgcggccc accagacgga caaagtgttt tcgcgcacag cactcacggt actgcacaac       780
     cacggctggc ccggcaacgt tcgggaactg cgcaatgccg tgcaacgcgg ctacatcctt       840
     ggcgaaaaga cggtcgatct ggacaatccg atcagctcgc cgcgcggccc tacccgaccg       900
     accgtcaagg aaggcgtgct gaacctgtcg gtcggcgtca cgctggccga ggcccagcgc       960
     gccatgatcc tggccacgct cgagcatttc cacggcgaca agcgccaggc ggccaagacg      1020
     ctcggcgtca gcctgaagac gctgtacaac cgcctggatc tctatcaagg cgcggcggcc      1080
     gctggcatgg cggcctga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page