(data stored in ACNUC7421 zone)

EMBL: CP001069.PE80

CP001069.PE80        Location/Qualifiers
FT   CDS_pept        89396..90217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3842"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_A3610 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3842"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28956"
FT                   /db_xref="GOA:B2UHA5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA5"
FT                   /protein_id="ACD28956.1"
FT                   /translation="MKLDKKVAVVTGAAGGLGKAIALAYADAGAKLVVCDINTTALEVT
FT                   RAEIESRNAECLALHCDVGSSSAVANLFEQVDAHFGTVHVLVNNAAVIPSQPVDEQRRL
FT                   QHYAYLTTPQPRHTLGFTSSMTDDDWHRFWDVNVHGVFYCTREALKRMEPQGDGKVINI
FT                   ASIAGLAALSAHSPHYSATKGAVVAFTRSVAAEVAGANIFVNAIAPGGVHTDHFEALLQ
FT                   GIGEEKRNQLFQLVPLGRLGTPEEYASLAVYLAADGHYIAGQIISPNGGMF"
     atgaagctgg ataagaaggt tgccgtggtg acaggggcgg ctggcggttt ggggaaagcc        60
     atcgcattgg cctacgccga tgcgggtgcc aagctcgtcg tttgcgacat caacacgact       120
     gcgctggaag tgacccgtgc cgagatcgaa tcccgcaacg ctgaatgcct ggccttgcat       180
     tgtgatgtgg gatcgagcag tgccgttgca aacctgtttg aacaagtcga tgcgcacttc       240
     ggaacagtgc acgtcctcgt caacaatgcg gccgtgattc catcccagcc ggttgacgag       300
     cagcgccgcc tgcagcatta cgcctacctc acaacgccgc aaccgcgcca cacgctgggc       360
     tttaccagca gcatgaccga cgatgattgg catcgcttct gggatgtgaa cgtacatggc       420
     gttttctact gcacgcgtga ggcgctcaag cggatggagc cgcagggcga cggcaaggtc       480
     atcaatatcg cgtcgattgc ggggctggcg gcgctgagcg cgcacagccc gcactattca       540
     gcgaccaagg gcgccgtcgt ggcgttcacg cgctcggtgg cagccgaggt ggctggcgcc       600
     aatatcttcg tcaacgccat cgccccgggt ggtgtgcata ccgaccattt cgaagccttg       660
     cttcagggta tcggcgaaga gaagcgcaac cagctctttc aactcgtccc gctgggccgc       720
     ctgggcacgc ccgaggaata cgcctcgctt gccgtctatc tggctgcgga cgggcattac       780
     atcgcgggtc agatcatcag cccgaatggc gggatgttct ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page