(data stored in ACNUC7421 zone)

EMBL: CP001069.PE82

CP001069.PE82        Location/Qualifiers
FT   CDS_pept        complement(92176..93480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3844"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); PFAM: General substrate transporter;
FT                   major facilitator superfamily MFS_1; KEGG: rso:RSp0075
FT                   putative alpha-ketoglutarate permease transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3844"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28958"
FT                   /db_xref="GOA:B2UHA7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA7"
FT                   /protein_id="ACD28958.1"
FT                   /translation="MDTTATPHAVDPHDTRRRIFAIVGASSGNLVEWFDFYVYAFCSLY
FT                   FAPAFFPSGDRTTQLLNTAGVFAAGFLMRPIGGWLFGRIADKHGRRAAMMISVLMMCGG
FT                   SLVIAVVPTYAQIGALAPFILLLARLFQGLSVGGEYGTSATYMSEVALKGRRGFFASFQ
FT                   YVTLIGGQLCALLVLVVLQQLLTTAELKAWGWRIPFAVGALTALVSLYLRKSLQETQTV
FT                   ASRTAKGAGTIRGAWQHKGAFLRVIGFTAGGSLIFYTFTTYMQKYLVNTAGMNTKVASN
FT                   VMTAALFVYMVLQPVFGALSDRIGRRTSMLFFGVLSVLGTVPLMHALATVSSPYAAFGL
FT                   ITVALAIVSFYTSISGLIKAEMFPPEVRAMGVGLSYAIANAVFGGSAEYVALWFKKAGT
FT                   EPTFYWYVTALCALSLVVTYFMPDPSKEGYLRNEP"
     atggatacca ctgccacccc gcacgcagtc gacccgcacg acacgcgccg ccgcatcttt        60
     gccatcgtcg gcgcctcgtc gggcaacctc gtcgaatggt tcgacttcta cgtctacgcg       120
     ttctgctcgc tgtacttcgc gccggccttc ttccccagcg gcgacaggac gacgcagctc       180
     ctgaacacgg ccggcgtgtt cgcagcgggc ttcctcatgc ggccgattgg cggctggctg       240
     tttggccgca ttgcggacaa gcacggccgg cgcgccgcga tgatgatctc ggtgctgatg       300
     atgtgcggtg gctcgctcgt gatcgccgtg gtgccgacgt atgcgcagat cggcgcgctc       360
     gcgccgttca tcctcctgct cgcacgcctg ttccagggcc tgtcggtggg cggcgagtac       420
     ggcaccagcg cgacctacat gagcgaagtc gcgctcaagg gccgtcgcgg cttcttcgca       480
     tcgttccagt atgtgacgct gatcggcggt caactgtgcg cgctgctcgt gcttgtcgtc       540
     ctgcagcagt tgctcaccac ggccgagctg aaggcctggg gctggcgcat tccgtttgca       600
     gtgggcgcgc tgacggcgct ggtctcgctg tacctgcgca agtcgctgca ggaaacgcag       660
     accgttgcgt cgcgcaccgc caagggcgcc ggcacgattc gcggggcctg gcagcacaag       720
     ggcgcattcc tccgtgtgat cggatttacc gccggcggct cgctgatctt ctacacgttc       780
     accacgtaca tgcagaagta cctcgtcaac acggcgggca tgaacaccaa ggtggcttcc       840
     aacgtgatga cggcggcgct gtttgtttac atggtgctgc aaccggtgtt cggggcgctg       900
     tctgaccgca ttggccggcg cacctcgatg ctgttctttg gcgtgttgtc ggtgctcggc       960
     acagtcccgc tgatgcatgc gctggccacg gtgtcgagcc cctatgcggc cttcggcctg      1020
     atcacggtgg cgctggccat cgtgagcttc tacacgtcga tcagcggcct gatcaaggcc      1080
     gagatgttcc cgccggaagt gcgcgcgatg ggcgtcggcc tgtcgtatgc gattgccaac      1140
     gcggtgttcg gcggttcagc cgaatacgtg gcgctctggt tcaagaaggc cggtaccgag      1200
     ccgacgttct actggtacgt gactgcgctg tgcgcgttgt cgctggtggt gacgtacttc      1260
     atgccggatc cgagcaagga agggtatctg cgcaacgagc cgtaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page