(data stored in SCRATCH zone)

EMBL: CP001069.PE83

CP001069.PE83        Location/Qualifiers
FT   CDS_pept        complement(93664..94884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3845"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS05543 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3845"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28959"
FT                   /db_xref="GOA:B2UHA8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHA8"
FT                   /protein_id="ACD28959.1"
FT                   /translation="MSASPASPTPSATTAPAATHSDTQGLIRLLTAGAGISVACIYLNH
FT                   PLLGLISRDLNIAPNALGVLPTLTAAGYASGIFFFGPLGDRYDRRLVILWKAVLLTLAL
FT                   IGSCLAPNLPLLAAAGFAIGLSATIAQDFVPSAAAISTDHNRNRNIGTVMTGLLIGIVS
FT                   SRVFSGIVADHFGWRAAFGVSAVAIVGLAIAVRASHFGVTPATRQPYFTLLRSLGTLFM
FT                   QHPRLRASALTQAFIGIAFSGFWSTVALHLTRSLGLSTGQAGLLGLAGAAGALGASIAG
FT                   RLSGRVAPGRIAAGGALLMAVTFASMAMFPQSLIAIVIGTLVFDVGVQAALVSHQTIIY
FT                   ALAPEARSRINAVFMTALFIGMSVGAYGASLAWNAGRWSGLMTFCASASLVALGLRALF
FT                   NARLGAH"
     atgtcggcct cgcctgcgtc ccctacacct tccgccacca ctgcgcccgc ggccacccac        60
     agtgacacgc aagggctcat ccgcctgctg actgccggtg cgggtatcag tgtggcgtgc       120
     atctacctga accacccgct gctcggtctg atcagccgcg acctgaacat cgcgccaaat       180
     gcgttgggcg tgctgcctac gctcacggcg gcaggctacg ccagcggcat cttcttcttc       240
     gggccgttgg gcgaccgcta cgaccgccgc ctcgtgatcc tgtggaaggc ggtcctgctg       300
     acgctggcgc tcatcggcag ctgcctggca cccaacctgc cgctgctggc ggccgcgggc       360
     tttgcgatcg ggctgtcggc caccatcgcg caggacttcg tacccagcgc cgccgccatc       420
     agcacggacc acaaccgcaa tcgcaacatc ggcacggtaa tgaccggtct tttgatcggc       480
     atcgtcagtt cacgcgtgtt cagcggcatc gtggcagacc acttcggctg gcgggcggcg       540
     tttggcgtgt cggcagtggc catcgtcggg ctggctatcg ccgtgcgggc atcccatttt       600
     ggcgtgacac ctgccacgcg gcagccgtac ttcacgttgc tgcgctcgct gggcacgctg       660
     ttcatgcagc atccgcgcct gcgtgcgtcg gcgctgacac aggcgttcat cggtatcgcg       720
     ttctcgggat tctggtcgac ggttgcgttg catctgacgc gttccctggg gctgtcgacg       780
     gggcaagccg gcctgctggg gctggccggc gccgcagggg cgcttggcgc gagtattgcg       840
     ggccggctgt cgggtcgcgt ggcgccgggc cgcatcgctg ccggcggcgc gctgctgatg       900
     gcggtcacgt ttgcctcgat ggcgatgttc ccgcagtcgc tcatcgccat cgtgatcggc       960
     accctggtgt tcgatgtggg cgtgcaggcg gcattggttt cgcatcagac catcatctac      1020
     gcgctggccc ccgaagcgcg cagccgcatc aatgcagtgt tcatgaccgc attgttcatc      1080
     ggcatgtcag taggggctta cggtgcaagc ctggcgtgga atgccggacg ctggtcgggc      1140
     ctgatgacgt tctgcgcgtc ggcgtccctg gtggcactgg gcttgcgggc actgttcaac      1200
     gcgcggctgg gcgcacactg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page