(data stored in ACNUC7421 zone)

EMBL: CP001069.PE85

CP001069.PE85        Location/Qualifiers
FT   CDS_pept        complement(95985..96536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3847"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: rso:RS05541
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3847"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28961"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB0"
FT                   /protein_id="ACD28961.1"
FT                   /translation="MKTPETLSTTPASDLVPSMDPPCSIAAAVSIVGEKWTLLVLREAF
FT                   SGVTRFDEFLRRTGCSSAILSSRLKALVTYGILRRVPYQEPGDRVRDAYKLTRAGVDLL
FT                   PAIVALMQWGDRYLTPDGEGPILLRDRESGTPIHVALVNALGEPVAPKNSMREPNPRYG
FT                   HGNDPASTAPAPADTSAADE"
     atgaagacac ccgagactct ctccaccacg ccggcgtccg acctggtgcc gtcgatggat        60
     ccgccctgtt ccatcgcggc cgcggtgtcg atcgtcggtg agaaatggac gctgctggtg       120
     ttgcgcgaag cgttttcggg cgttacgcgt ttcgatgagt tcctgcgccg cacggggtgc       180
     tcgtcggcga tcctgtcgtc gcggctcaag gcgctggtga cgtacggcat cctgcgccgc       240
     gtgccttacc aggagccggg cgaccgcgta cgcgacgcgt acaagctgac gcgcgcgggc       300
     gtcgatctgt tgcccgccat cgtggcgctg atgcagtggg gcgaccggta tctcacgccc       360
     gacggtgaag gcccgatcct gctgcgcgat cgcgagagcg gcacgccgat tcacgtggcg       420
     ctggtcaatg cattgggcga gccggtcgcg cccaagaatt cgatgcgcga gccgaacccg       480
     cgttatggtc acggcaacga cccggcatcc acggcacccg cccccgcaga cacgtctgcg       540
     gccgacgaat aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page