(data stored in ACNUC7421 zone)

EMBL: CP001069.PE87

CP001069.PE87        Location/Qualifiers
FT   CDS_pept        97487..97921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3849"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_B2073
FT                   glyoxalase/bleomycin resistanceprotein/dioxygenase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3849"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28963"
FT                   /db_xref="GOA:B2UHB2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB2"
FT                   /protein_id="ACD28963.1"
FT                   /translation="MSDVTPVLAPFHLAFPVHDIAAARAFYGGVLGCPEGRSAPDWVDF
FT                   NFYGHQIVAHLAPEEAGHRKTSAVDGDAVPVRHFGVVLSMPEWDAAANKLRAAGVDFII
FT                   EPHIRFKGEVGEQATMFFLDPSGNALEIKAFANMASLFAK"
     atgagcgacg tcacgcctgt ccttgcccct tttcacctcg cgttcccggt gcacgacatt        60
     gccgcagcac gcgcgttcta cggtggggtc ctcggctgtc cggagggccg cagcgcgccg       120
     gactgggtcg atttcaattt ttacggccat cagatcgtcg cgcatctggc acccgaggag       180
     gccggccatc gcaagaccag cgccgtcgat ggtgacgccg tgccggtgcg gcatttcggc       240
     gtcgtgctgt ccatgccgga gtgggatgcc gccgccaaca agctgcgcgc tgcgggcgtc       300
     gacttcatca tcgagccgca catccgcttc aagggcgagg tgggcgagca ggccacgatg       360
     ttcttcctcg atccgtcggg caacgcgctg gagatcaagg cattcgccaa catggcatcg       420
     ctgttcgcca agtga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page