(data stored in SCRATCH zone)

EMBL: CP001069.PE90

CP001069.PE90        Location/Qualifiers
FT   CDS_pept        complement(99735..101033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3852"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS03015 putative transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3852"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28966"
FT                   /db_xref="GOA:B2UHB5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB5"
FT                   /protein_id="ACD28966.1"
FT                   /translation="MQRLARLIAPRFHYSWIALAVVFLILLCAAGTRATPSVMMLPLEH
FT                   EFGWSRSTISLAISIGIALYGLTGPFAAASMQYFGIRPTVLGALAVLVSGTALSAMMHE
FT                   PWQMVLLWGVMVGGGTGVAAITLGATVVNRWFTSHRGLAMGILTASSATGQLVFLPMMA
FT                   AVVEHYGWRPVVLIVAGALALLLPIVALLLPESPRSVGLRTYGEPADAPETSQGPRANP
FT                   ISLAMQTLVQAMRKRDFWLLFASFFICGASTNGYIGTHFIAMCADHGFSEVKGASLLAA
FT                   MGIFDLVGTTLSGWLSDRYNSRVLLFWYYGLRGLSLIYLPYAFGFEFFGLPVFAIFYGL
FT                   DWIATVPPTVRLTNDVFGKAAAPIVFGWIVAGHQLGAAFATLGAGMMRASLGNYTLSSM
FT                   ISGGLCVAGAFLVLRIHRTPKQDAGRAGQPATA"
     atgcagcgac ttgcccgcct catcgcccca cgttttcact acagctggat cgccctggcc        60
     gtcgtgttcc tgatcctgct gtgtgcggcc ggcacccgcg ccacgcccag cgtgatgatg       120
     ctgccgctgg agcacgagtt cggctggagc cgcagcacga tctcgctggc catctcgatc       180
     ggcattgcgc tgtatggact gacgggcccg tttgcggccg cgtcgatgca gtacttcggc       240
     atccgcccca ccgtgctcgg cgcgctggcg gtgctggtgt cgggcacggc gctctcggcg       300
     atgatgcacg agccgtggca gatggtgctg ctgtggggcg tcatggttgg cggcggcacc       360
     ggcgtggcag ccatcaccct gggcgcgacg gtggtcaacc gctggttcac gtcgcaccgg       420
     ggcctggcga tggggattct caccgccagc tcggctacgg gccagctcgt gttcctgccg       480
     atgatggcgg cggtggtgga gcactacggc tggcgcccgg tggtgctgat cgtggcgggt       540
     gcgctggcgc tgctgctgcc gatcgtggcg ctgctgctgc cggagtcgcc caggagcgtg       600
     ggcctgcgca cctatggcga gcccgccgat gcgccggaaa ccagccaggg cccgcgcgcc       660
     aaccccatct cgctggccat gcagacgctc gtgcaggcca tgcgcaagcg cgacttctgg       720
     ctgctgttcg cgagcttctt catctgcggc gcaagcacca acggctacat cggcacgcac       780
     ttcatcgcca tgtgcgcgga ccacgggttc tctgaagtga agggcgcgag cctgctggcg       840
     gccatgggga tcttcgacct ggtcgggacc acgctgtcgg gctggctgtc cgaccgttac       900
     aacagccgcg tgctgctgtt ctggtactac ggcctgcgcg ggctctcgct gatctacctg       960
     ccgtatgcgt tcggcttcga attcttcggc ctgcccgtgt ttgccatctt ctacgggctg      1020
     gactggatcg ccaccgtgcc gcccaccgtg cgcctgacca acgacgtgtt cggcaaggcc      1080
     gccgcgccca tcgtgttcgg ctggatcgtg gccggccacc aactgggcgc ggcgttcgcg      1140
     acgctgggtg cgggcatgat gcgcgcctcg ctgggcaact acacgctgtc gtcgatgatc      1200
     tccggcggtc tgtgcgtggc cggcgccttc ctggtgctgc gcattcatcg cacgcccaag      1260
     caggacgccg ggcgtgccgg ccagccggcc acggcctga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page