(data stored in ACNUC7421 zone)

EMBL: CP001069.PE91

CP001069.PE91        Location/Qualifiers
FT   CDS_pept        101195..101836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3853"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rso:RS03014
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3853"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28967"
FT                   /db_xref="GOA:B2UHB6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB6"
FT                   /protein_id="ACD28967.1"
FT                   /translation="MAARGPRTVSTVEQPKPGPRRISGEDAHASLLEAARQLFYYEGVR
FT                   AVGVEAVVEKAGVNKMSLYRQFKSKDDLVLAYLERSDESFWGYFDNSMAKHPDDARAQL
FT                   LQFFIDVSERASRPGYRGCPFVNVAAEFPDLSHAARQFVQRNKARLLARLRERAEAAGA
FT                   ADPDALADDLAFLIEGAYTASQTFGTDAPRLIKCLPRTARVLLDANIPAR"
     atggcagcac gcggcccacg caccgtttcc accgttgaac aacccaagcc cggcccgcgc        60
     cgcatcagcg gtgaagacgc gcacgccagc ctgctcgagg cggcgcgcca gctgttctac       120
     tacgaaggcg tgcgtgccgt gggcgtcgag gccgtggtcg agaaggccgg tgtcaacaag       180
     atgagcctgt accgccagtt caagtcgaag gacgacctcg tgctcgcgta cctggagcgc       240
     agcgacgaga gcttctgggg ctacttcgac aacagcatgg ccaaacaccc ggatgacgcc       300
     cgtgcgcagc tgctgcagtt cttcatcgat gtctcggaaa gggcgtcgcg cccgggttat       360
     cgcggttgcc cgttcgtgaa cgtggcggcc gagtttcccg atctgtcgca cgccgcgcgg       420
     cagttcgtcc agcgcaacaa ggcgcggctg ctggcgcggc tgcgcgagcg tgccgaagcc       480
     gccggcgccg ccgaccccga tgcgctggcc gacgatctgg ccttcctgat cgaaggggcg       540
     tacaccgcca gccagacctt cggcaccgac gcaccgcgcc tcatcaagtg cctgccgcgc       600
     acggcccgcg tgctgctcga tgccaacatc ccggcgcgct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page