(data stored in ACNUC7421 zone)

EMBL: CP001069.PE92

CP001069.PE92        Location/Qualifiers
FT   CDS_pept        101968..102939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3854"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: rso:RS03013
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3854"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28968"
FT                   /db_xref="GOA:B2UHB7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB7"
FT                   /protein_id="ACD28968.1"
FT                   /translation="MTPNQVPLSPVRTAPAAGMQPSSLPAALLQAQRALDRIVLGKPLQ
FT                   IRLALACLLSRGHLLLEDLPGVGKTTLAHALARTLGLQYQRVQFTSDLLPADLIGVSIY
FT                   VKEKGAFEFHPGPLFAQVVLADEINRATPKAQSALLEAMAEGQVTHDGATYPLPEPFFV
FT                   IATQNPLNQIGTHPLPESQLDRFTMRLSLGYPDQHSERALYLGGGARQDIEPVLTAAQV
FT                   VALQAGADAVHAAPALVDYVLALVNATRTDAQVQMGLSPRAGLALLAAARAWALVDGRD
FT                   AVLPEDVQAVFTAVAAHRLLPTGGTLSATALAQRLLDTVAIP"
     atgacgccca accaagttcc gctttcgccc gtacgcacgg cgccggccgc cggcatgcag        60
     ccgtcgtctt tgcctgccgc gctcctgcag gcgcaacgcg cgctcgatcg catcgtgctg       120
     ggcaagccgc tgcagatccg gctggcgctg gcgtgcctgc tgtctcgcgg gcacctcttg       180
     ctcgaagact tgccgggggt gggcaagacc acgctggcgc acgcactggc ccgcacgctc       240
     ggcctgcaat accagcgcgt gcaattcacc agcgacctgc tccccgctga cctgatcggc       300
     gtgtcgatct acgtgaaaga gaagggcgcc ttcgagttcc atccgggccc gctgttcgcg       360
     caagtggtgc tggccgacga gatcaaccgc gccacgccca aggcgcagag cgccctgctc       420
     gaagccatgg ccgaagggca ggtcacgcac gatggcgcga cgtacccgct gcccgaaccg       480
     ttcttcgtga tcgcgacgca aaacccactc aaccagatcg gcacgcatcc gctgcccgag       540
     tcgcagctcg accgtttcac gatgcggcta tcgctcggct accccgatca gcattcggag       600
     cgcgcgctct atctgggtgg cggcgcgcgg caggacatcg agccggtgct gaccgctgca       660
     caggtcgtcg cattgcaggc cggcgcggat gccgtgcacg cggcgccggc gctggtcgac       720
     tacgtgctgg cactggtcaa cgccacgcgc accgacgcgc aggtgcagat gggcctgtcg       780
     ccgcgtgcgg ggctcgcgct gctggccgcc gcacgtgcgt gggctctggt cgacggccgc       840
     gacgcggtgt tgcccgaaga cgtgcaggcc gtgttcacgg ccgtggccgc gcaccggctg       900
     ctgcccacgg gtggcacgct ttcggcgact gccctggcgc agcggctgct cgataccgtg       960
     gccatcccct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page