(data stored in ACNUC7421 zone)

EMBL: CP001069.PE93

CP001069.PE93        Location/Qualifiers
FT   CDS_pept        102952..104025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3855"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   rso:RS03012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3855"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28969"
FT                   /db_xref="GOA:B2UHB8"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB8"
FT                   /protein_id="ACD28969.1"
FT                   /translation="MARVASVLAVPLRALGAGLAALPGVRLARTRVQRFLQRPRTPREG
FT                   RIRLDRNHVYILPTGAGASFALLLIVMLLTSLNYNVSLGFLLTFVLAGVAASAMWQTHR
FT                   NLVDLEVRGAVGEAVFAGHALNVSVALANVTSWARVGVDVSAREAAAVETSLDARDAIV
FT                   AALSFAGQPRGWFRLPRLTVSTRFPLGLFRAWSYADAPLTLLIYPAPEPAAPPLPANFV
FT                   PDPGEEPSATTPRTHVEDAVDQLRPYRPGDPLRSIAWKHSARLDTWMSRTGQQVHHAQC
FT                   VLAWDALPASMHVEQRLSRLCAWVLAAEQGMAGEAPEYTLSLPGITLGPSRGPAHRDAC
FT                   LRALALWGKPAMPEDAS"
     atggcgcgtg tcgcttccgt gctggcggtg ccgctgcgtg cgctgggtgc cgggctggct        60
     gcgttgccgg gcgtccgcct ggcgcggacg cgcgtgcagc gctttctgca gcggccgcgc       120
     acgccgcgtg aaggccgcat ccgcctcgac cgcaatcacg tctacatcct gcccaccgga       180
     gcgggggcca gctttgcgtt gctgctgatc gtgatgctgc tgacttccct gaactacaac       240
     gtgagcctgg gcttcctgct gacgttcgtg ctggcaggcg tggcagcctc cgccatgtgg       300
     cagacgcatc gcaacctggt ggacctggag gtgcgcggcg cagtgggcga agccgtcttc       360
     gcggggcacg cactgaacgt gagtgtggcg ctggccaacg tcacgtcgtg ggcgcgcgtc       420
     ggggtggacg tgagcgcgcg cgaggccgcc gcggtggaga cgtcgctcga tgcgcgggat       480
     gccatcgttg cggcgctgtc attcgcgggg cagcctcgcg ggtggttccg cctgccgcgc       540
     ctgacggtgt cgacgcgctt tccgctcgga ctgttccggg cgtggagcta tgccgatgcc       600
     ccgctcaccc tcctgatcta tcccgcgcct gagcccgctg cgccgccgct gcccgcgaac       660
     ttcgtgcccg acccgggcga agagcccagc gcgaccaccc cccgtaccca cgtcgaagac       720
     gccgtcgatc agcttcgccc ctaccgtcct ggcgacccgc tgcgcagcat cgcgtggaag       780
     cacagcgcgc ggctggacac ctggatgagc cgcaccggcc agcaggtgca ccacgcgcag       840
     tgtgtcctcg cgtgggatgc gcttccagcg tcgatgcatg tggagcaacg gctgtcgcgg       900
     ctgtgcgcct gggtgctggc cgcggagcag ggcatggccg gcgaagcacc ggaatacacg       960
     ctgagtctgc ccggtatcac gctcggtccg tcgcgcggcc cggcgcatcg ggatgcctgc      1020
     ctgcgcgcat tggcgctgtg gggcaagccg gccatgccgg aggacgcgtc gtga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page