(data stored in ACNUC7421 zone)

EMBL: CP001069.PE94

CP001069.PE94        Location/Qualifiers
FT   CDS_pept        104022..106046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3856"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   rso:RS03011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3856"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28970"
FT                   /db_xref="GOA:B2UHB9"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR021878"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHB9"
FT                   /protein_id="ACD28970.1"
FT                   /translation="MSLATGTPLFGPTRALTHREHGWLIAQLAIVLAPLLRALPLVTCA
FT                   VFGVLLLLRTLLWVRRAPLPGKWVLGLTGLATLLVTLALALRTGGNIGRDLSVALLGAF
FT                   LVLKLMESHTVRNGILVTQLCCFLLLSQVLFDQPPWLAATMLATAALLLRNWLLLLHPQ
FT                   ARLRVSPVRVLIRLVAMGLPCAAVLFLLFPRLDHPLWSLPRSAETGTSGISDRMAPGSI
FT                   GQLILSDELAFRADFSGTPPPLDTLYWRGMVLWRFDGQAWTAVSIRQRPARGGVPDSAD
FT                   SAGAVPDAVNYNITLEATHQRWLFALDRGVSIDARDDIGRSIDSEFISKQPLDQRMRYH
FT                   ARSRLPDRNRVDDAQPLDPFTQQLALALPPGNPQARALAAQWAGLPPAERVSAALRLFG
FT                   RAPFAYTLQPEPLQGQQIDDFLFRTHRGFCEHYAGSFVFLMRAAGVPARVVVGYLGGEV
FT                   NAMSGDIIVRQSDAHAWAEVWLAGRGWVRVDPTAAVAPQRVERGLAAAVPASEFRSRRV
FT                   EEPTWLRSVRWGLDGLISGWNRWVLGYDRTRQAQLFAWLGLDAADPRAVLWGVSAIFLL
FT                   AALPLLWQQRKPRLDPVQAQWQRLCDRLARHGCARGPAEGPIAYAERAAAQFPAAAPAL
FT                   RQAAAGYVALRYGRDDGDARARAQRFTEWRTALARVRLR"
     gtgagtcttg cgaccgggac tcccttgttc ggcccgacgc gcgcgctcac gcaccgcgag        60
     cacggttggc tgatcgctca gcttgcgatt gtgctggccc cgctgctgcg cgcgctccct       120
     ctggtgacat gcgcggtgtt cggggtgctg ctgctcctgc gcacgctgtt gtgggtgcgc       180
     cgcgcaccgt tgccgggtaa atgggtgctg gggctgaccg gcctcgccac gctgctcgtc       240
     acgctggcgc tggccctgcg caccggcggc aatatcgggc gcgacctctc cgtggccctg       300
     ctgggcgcgt ttctcgtgct caagctcatg gaatcacaca ccgtgcgcaa cggcattctc       360
     gtgacgcagt tgtgctgctt cctgctgctc tcgcaggtgc tgttcgacca gccgccgtgg       420
     ctggccgcca ccatgctggc gacggcggcg ctgttgctgc gcaactggct gctgctgttg       480
     catccacagg cgcgcctgcg cgtctcgccg gtgcgtgtgc tgatccgctt ggtcgcgatg       540
     ggcctgccgt gcgcggcggt gctgttcctg ctgttcccgc gcctggacca cccgctctgg       600
     agcctgccgc gatccgccga aaccggcacc agcggtatct ccgaccgcat ggcaccgggt       660
     tcgatcggcc aactgatcct gtcggacgaa ctcgccttcc gtgccgactt cagcggtacg       720
     ccgcccccgc tcgacacgct ctattggcgc ggcatggtgt tgtggcgttt tgacggccag       780
     gcatggactg ccgtctcgat tcggcagcgg cctgcgcgtg ggggcgtacc cgattctgcg       840
     gacagcgcag gcgccgtgcc cgacgccgtc aactacaaca tcacgctgga ggcgacgcac       900
     cagcgctggc tgttcgcact cgatcgtggc gtgtcgatcg acgcacgcga cgacattggc       960
     cgcagtatcg attcggagtt catcagcaag cagccgctcg accagcggat gcgctaccac      1020
     gcgcgttcgc gcctgcccga tcgcaatcgc gtggacgatg cacagccgct cgatccgttc      1080
     acgcagcagt tggcgctcgc gctgccgccc ggcaacccgc aggcacgtgc gcttgccgcg      1140
     cagtgggccg ggttgccgcc cgccgagcgt gtgtcggccg cactcaggct gtttggtcgc      1200
     gccccgtttg cctacacgct ccaacccgag cccctgcagg gccagcagat cgacgatttc      1260
     ctctttcgca cacaccgcgg cttctgtgag cactacgcgg gcagctttgt cttcctgatg      1320
     cgcgcggcgg gcgtgccggc acgcgtggtg gtgggctacc tcggcggcga ggtgaacgcc      1380
     atgagcggcg acatcatcgt gcgtcagtcc gatgcgcacg cgtgggcgga ggtgtggctg      1440
     gccggccgtg gctgggtgcg cgtggacccg accgccgccg tcgcgccgca gcgcgtcgag      1500
     cgcgggctgg ccgccgccgt tcctgccagc gagttccgct cgcgccgcgt ggaggagccc      1560
     acgtggctgc gcagcgtgcg ctgggggctg gacggcctca tcagcggctg gaaccgctgg      1620
     gtgctcggct acgaccgcac tcggcaggcc cagctgttcg catggctcgg cctggatgcc      1680
     gccgacccgc gtgcggtcct gtggggtgtg tcggcgatct ttctgctggc cgcattgccc      1740
     ctgttgtggc agcagcgcaa gcccaggctt gatccggtgc aggcgcagtg gcaacgtctg      1800
     tgcgaccgcc tggcacggca cggatgtgca cgcggtccgg cggaagggcc catcgcctac      1860
     gccgagcgtg ccgccgcgca gtttccagca gcggcaccag cgctgcgaca ggccgccgcc      1920
     ggctatgtcg ccctccgcta cggccgtgac gatggtgacg ctcgggcgcg ggcgcagcgt      1980
     ttcaccgagt ggcgcactgc cctcgcgcga gtccgcctgc gctaa                      2025
//

If you have problems or comments...

PBIL Back to PBIL home page