(data stored in ACNUC7421 zone)

EMBL: CP001069.PE96

CP001069.PE96        Location/Qualifiers
FT   CDS_pept        complement(107724..108911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3858"
FT                   /product="AcnD-accessory protein PrpF"
FT                   /note="TIGRFAM: AcnD-accessory protein PrpF; PFAM: protein
FT                   of unknown function DUF453; KEGG: rso:RS03003 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3858"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28972"
FT                   /db_xref="GOA:B2UHC1"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="InterPro:IPR012709"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHC1"
FT                   /protein_id="ACD28972.1"
FT                   /translation="MSHPAQVKIPATYMRGGTSKGVFFRLQDLPPAAQQPGAARDALLM
FT                   RVIGSPDPYGKQIDGMGGATSSTSKTVILSKSTRPDHDVDYLFGQVSIDKPFVDWSGNC
FT                   GNLSAAVGPFAISNGLVDASRVPQNGTAIVRIWQANIGKTIIAHVPITNGAVQETGDFE
FT                   LDGVTFPAAEVQLEFLDPAAEEDGDGGGAMFPTGNLVDDLDVPGVGTLKATMINAGIPT
FT                   IFINAEAIGYTGTELQDAINGDAKALAMFETIRAHGAVRMGLIKSIDEAATRQHTPKVA
FT                   FVAPPKDYVASSGKQVGAGDVDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLA
FT                   AGGGERGAVRFGHPSGTLRVGAEAKLVDGEWTVTKAIMSRSARVLMEGWVRVPGA"
     atgagccacc ccgcgcaagt gaagattccc gccacgtaca tgcgtggcgg caccagcaag        60
     ggcgtgttct tccgtctgca agacctgccg ccggcagcac agcagcccgg cgctgctcgc       120
     gacgccttgc tcatgcgcgt gatcggcagc cccgacccat acggcaagca gatcgacggc       180
     atgggcggcg ccacgtcgag caccagcaag acggtgatcc tcagcaagag cacgcgcccg       240
     gaccacgacg tggattacct gttcggccag gtctccatcg acaagccgtt tgtggactgg       300
     tcgggcaact gcggcaacct ctccgcagcg gtcggcccct ttgccatcag taacggcctg       360
     gtcgatgcga gccgtgtacc gcagaacggc accgccatcg tgcgcatctg gcaggccaac       420
     atcggcaaga ccatcattgc gcacgtgccc atcaccaacg gcgcggtgca ggagacgggc       480
     gactttgagc tggacggcgt gaccttcccg gcggcggaag tgcagctcga attcctcgac       540
     cccgcagccg aggaagacgg tgacggcggc ggcgcgatgt tccccaccgg caacctcgtc       600
     gacgacctgg acgtgcccgg cgtgggcacg ctcaaggcga cgatgatcaa cgcgggcatc       660
     ccgacgatct tcatcaacgc agaggccatc ggctacaccg gcaccgagct gcaggacgcc       720
     atcaacggcg atgcgaaggc gctggcgatg ttcgagacca tccgcgcgca cggcgcggtg       780
     cgcatggggc tgatcaagag catcgatgaa gccgccacgc ggcagcacac gccgaaggtg       840
     gcgtttgtcg caccgccgaa ggactacgtg gcgtcgagcg gcaagcaggt cggcgcgggc       900
     gatgtggact tgctggtgcg cgcgctgtcg atgggcaagc tgcaccacgc gatgatgggc       960
     acggcggcgg tggccattgg tacggcagcg gccattcctg gcacgctggt caacctggcg      1020
     gccggcggcg gagaacgtgg tgcggtgcgc ttcgggcatc cgtcgggcac gctgcgcgtg      1080
     ggcgcggagg ccaagctggt ggacggcgaa tggacggtca ccaaggccat catgagccgc      1140
     agcgcacgcg tgttgatgga aggctgggtg cgcgtgccgg gcgcctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page