(data stored in ACNUC30630 zone)

EMBL: CP001096.PE10

CP001096.PE10        Location/Qualifiers
FT   CDS_pept        complement(12809..13318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0010"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bra:BRADO0760 putative transcriptional regulatory protein,
FT                   AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98572"
FT                   /db_xref="GOA:B3QK08"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK08"
FT                   /protein_id="ACE98572.1"
FT                   /translation="MTDIDSVVAESNRRLDAIDRKILTVLQQDASLSVAEIGDRVGLSS
FT                   TPCWKRIQRLEADGVIIKRVALVDQDKIGLGLSVFVSIESGDHSDAWLKTFADAVSAMP
FT                   EVIEFYRMAGDVDYMLRVVVADMRAYDQFYKKLIGTVPLKNVTSRFAMEKIKSVTALPV
FT                   PPMPVS"
     atgaccgaca tcgacagcgt cgtcgccgaa tccaaccgtc ggcttgatgc gattgaccgc        60
     aaaattctga ccgtgctgca gcaggacgcc tcactgtccg tggccgagat cggcgatcgg       120
     gtcgggctgt cgtcgacccc gtgctggaag cgtatccagc ggctcgaggc cgacggagtg       180
     atcatcaagc gggtggccct ggtcgatcag gacaaaatcg ggttggggct gtcggtgttc       240
     gtctcgatcg agagcggcga tcactccgat gcctggctga agacgtttgc cgatgccgtc       300
     agtgcgatgc ccgaggtgat cgagttctac cggatggccg gcgacgtcga ctacatgctg       360
     cgggtggtcg tcgcggacat gcgcgcctac gatcagttct acaagaagct gatcggcacc       420
     gtgccgctga agaacgtcac gtcgcgcttt gcgatggaga agatcaagtc ggtgacggcg       480
     ctgccggtgc cgccgatgcc ggtatcttaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page