(data stored in ACNUC30630 zone)

EMBL: CP001096.PE100

CP001096.PE100       Location/Qualifiers
FT   CDS_pept        107472..110621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0100"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   nha:Nham_0993 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98662"
FT                   /db_xref="GOA:B3Q633"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q633"
FT                   /protein_id="ACE98662.1"
FT                   /translation="MIADTFIDRPRLAAVIALVTTLVGALALLRIPVAQLPDIVPPQVR
FT                   VSTTYPGASAEVLESTVAQPIEAKVVGVDKMIYMKSSSGNDGSYTLDVSFALGTNPDIN
FT                   TVNVNNRVQNALSQLPSEVRLQGVTVQKRSSSMLQVINMSSTGQKYDQLFLTNYGLINV
FT                   LDELARVPGVGEAALFGRYAYSMRIWFDIEKLSSLGLVPSDVVAAISAQNVQAPVGRIG
FT                   ARPVPDDQKFQFNLQTQGRLTKPEEFGAIVLRANADGSVLKVSDVARVELGAQNADTYA
FT                   RLNGDPTIGIGIFLAPGANAINTAAAINAKLDTLRPRFPESVQARVVYDATVFVNDTIS
FT                   AVLHTLFEAFALVAVVVFLFLGNLRATLIPIIAVPVSLIGTFAVLIAFGTSVNTVSMLA
FT                   LVLAIGIVVDDAIVVVENVERVMEEEPELSPADATKKAMAQVTAPIIAITLVLLSVFVP
FT                   IGFLPGIMGELFRQFAVTISAAMLISAVNALTLSPAMCALFLRHEGQRRGFMQKVGRGI
FT                   DRARDGYTSTVRIALRRPALSVLAVAACGAGIWGLSLTTPSGFLPEEDQGAFFINVQLP
FT                   DGASVARTEATVIEVEKIVKQMPEVRDVLSIVGLSLLDNYSASNNAFMIVQLKPFADRK
FT                   AASSSAQTLIGKTFGATQAVRTATVLPFNLPPVVGLSTAGGFQYQLESLEGAEPAAIAG
FT                   VTNGLVAAGNQNPLLTRVFSTYNANAPSLYLDIDREKAQSLGITINDIFSALQISLGGL
FT                   YINNFNLFGRTWQVNLQGDASARRDLPNLWDIYVRNTKGAMVPLQSIATVRTVTGPAVI
FT                   TRYNNYRSVTINGSPAPGVSSGTAMAAMAEVSAKTLPPGYAFEWTGTAYQEHEAVGKTG
FT                   YILALAVIFAYLFLVALYESWVIPVPVLLSVSIAVLGAFAGILVGRVTLDLYAQIGLVV
FT                   LIALAAKNGILIVEFAKEQREAGLSIKAAAEMGAKLRFRAVMMTSIAFILGLVPLVWAD
FT                   GAAMLARRNLSTPVFAGMLTASLIGIILIPMLYVVFQSLREKVAEPGVLTPLSLKRLLK
FT                   R"
     atgatcgccg ataccttcat cgaccggcca cggctcgccg cggtcatcgc gctggtgacc        60
     acgctggtcg gcgccctggc gctgctgcgc attccggtgg cccagctccc ggacatcgtc       120
     ccgccgcagg tccgggtgtc gacgacctat cccggcgctt ccgccgaggt gctggaatca       180
     accgtggcgc agccgatcga ggccaaggtc gtcggcgtcg acaaaatgat ctacatgaag       240
     agttcgagcg gcaacgacgg ctcctatacg ctcgacgtct cgttcgcgct cggcaccaac       300
     cccgacatca acaccgtcaa cgtcaacaac cgcgtgcaga atgcgctgtc gcagcttccg       360
     tccgaggtac ggctgcaggg cgtgaccgtg cagaagcgct cgtcgtcgat gctgcaggtc       420
     atcaacatgt ccagcacggg gcagaaatac gaccagctgt tcctgaccaa ttatggcctg       480
     atcaacgtgc tggacgaact ggcccgtgtg cccggcgtcg gtgaggcggc gctattcggc       540
     cgctatgcct attcgatgcg gatctggttc gacatcgaaa agctatcgag cctgggcctg       600
     gtgccgtccg acgtcgtcgc cgcgatcagc gcccagaacg tgcaggcgcc ggtcgggcgg       660
     atcggcgcgc gcccggtgcc cgacgaccag aaattccagt tcaacctgca gacccagggc       720
     cggctgacca agccggagga gttcggcgcc atcgtgctgc gcgccaacgc cgacggttcg       780
     gtgttgaagg tctccgacgt cgcccgcgtc gagctcggtg cgcaaaacgc cgatacctat       840
     gcgcggctga acggcgatcc gaccatcggc atcggcatct tcctcgcgcc cggcgccaac       900
     gccatcaaca ccgccgccgc gatcaatgcc aagctcgaca cgctgcggcc gcgttttccg       960
     gagagcgtgc aggcacgcgt ggtctacgac gccaccgtgt tcgtcaacga caccatcagc      1020
     gccgtgctgc acaccctgtt cgaagccttc gcgctggtcg ccgtggtcgt gttcctgttt      1080
     ctcggcaatc tccgcgccac gctgatcccg atcatcgcgg tgccggtcag cctgatcggc      1140
     accttcgcgg tgctgatcgc gttcggcacc tcggtcaaca ccgtgtcgat gctggcgctg      1200
     gtgctggcga tcggcatcgt cgtcgacgac gccatcgtcg tggtcgagaa cgtcgagcgg      1260
     gtcatggaag aagagccgga gctgtcgccg gccgacgcca ccaagaaggc gatggcacag      1320
     gtcaccgcgc cgatcatcgc catcacgctg gtgctgctgt cggtattcgt gccgatcggc      1380
     ttcctgcccg gcatcatggg cgaattgttc cggcagttcg cggtgacgat ctcggccgcg      1440
     atgctgatct cggcggtcaa cgcgctgacg ctgtcgccgg cgatgtgcgc gctgttcctg      1500
     cgccacgaag ggcaacgccg cggcttcatg cagaaggtcg gccgcggcat cgaccgcgcg      1560
     cgggacggct acacctcgac ggtgcggatc gcgctgcgcc ggccggcgct gtcggtgctg      1620
     gcggtggcgg cctgcggcgc cggcatctgg gggctgtcgc tgacgacgcc gagcgggttt      1680
     cttcccgaag aggatcaggg cgccttcttc atcaacgtgc agctccccga cggcgcttcg      1740
     gtggcgcgca ccgaggcgac ggtgatcgag gtggaaaaga tcgtcaagca gatgccggaa      1800
     gtgcgcgacg tgctgtcgat cgtcgggctg tcgctgctcg acaactactc ggcctccaac      1860
     aacgccttca tgatcgtgca gctcaagccg ttcgccgatc gcaaggccgc gtcgtcgtcg      1920
     gcgcagacgc tgatcggcaa gactttcggc gcgacccagg cggtgcgcac cgcgaccgtg      1980
     ctgccgttca acctgccgcc ggtcgtcggc ctgtccactg ccggcggttt ccagtatcag      2040
     ctcgaatcgc tggaaggcgc cgagccggcg gcgatcgccg gcgtgaccaa cgggctggtc      2100
     gccgccggca accagaaccc gctgctcacc cgggtgttct cgacctacaa cgccaatgcg      2160
     ccgtcgctgt atctcgacat cgaccgcgag aaagcgcagt cgctcggcat caccatcaac      2220
     gacatcttct cggcgctgca gatctcgctc ggcgggctct acatcaacaa cttcaacctg      2280
     ttcggacgga cctggcaggt caacctgcag ggcgacgcga gcgcgcggcg tgacctcccc      2340
     aacctgtggg acatctacgt ccgcaacacc aagggcgcga tggtgccgct gcaatcgatc      2400
     gcaaccgtcc gcaccgtcac cggcccggcg gtgatcaccc gctacaacaa ttatcgttcg      2460
     gtgacgatca acggctcccc cgcacccggc gtctcctcgg gcaccgcgat ggccgcgatg      2520
     gccgaggtgt cggccaagac gctgccgccc ggctacgcgt tcgaatggac cggcaccgcc      2580
     tatcaggagc acgaggcggt cggcaagacc ggctacatcc tggcgctcgc ggtgatcttc      2640
     gcatacctgt tcctggtggc gctgtacgaa agctgggtga tcccggtgcc ggtgctgctg      2700
     tcggtgtcga tcgcggtgct cggcgccttc gccggcatcc tggtcggccg cgtcaccctc      2760
     gatctctacg cccagatcgg ccttgtggtg ttgatcgccc tcgccgccaa gaacggcatc      2820
     ctgatcgtcg aattcgccaa ggagcagcgc gaggccgggc tgtcgatcaa ggctgcggcc      2880
     gagatgggag ccaagctgcg ctttcgcgcc gtgatgatga cctcgatcgc cttcatcctc      2940
     ggcctggtgc cgctggtgtg ggccgacggc gcggcgatgc tggcgcggcg caatctgtcg      3000
     acgccggtgt tcgccgggat gctgaccgcc agcctgatcg gcatcatcct gattccgatg      3060
     ctgtacgtgg tgttccagtc gctgcgcgag aaagtcgccg agccgggcgt gctgacgccg      3120
     ctgtcgctga aacgtctgct gaagcgatga                                       3150
//

If you have problems or comments...

PBIL Back to PBIL home page