(data stored in ACNUC30630 zone)

EMBL: CP001096.PE101

CP001096.PE101       Location/Qualifiers
FT   CDS_pept        110760..111170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0101"
FT                   /product="protein of unknown function DUF1078 domain
FT                   protein"
FT                   /note="PFAM: protein of unknown function DUF1078 domain
FT                   protein; KEGG: bra:BRADO6624 putative flagellar basal-body
FT                   rod protein (FlgC)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98663"
FT                   /db_xref="GOA:B3Q634"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q634"
FT                   /protein_id="ACE98663.1"
FT                   /translation="MSAIASIAVSGLNAATRRLEVSASNIANQRSTGALPGADGTVPPG
FT                   APQAYKPLQVNQTDTPTGGTQTSLATTSPATVPVSDPQAPFADADGMVAAPNVDLAQEF
FT                   IGQMVAKYSYTANLASLQADRDMTKALLDAKV"
     atgtccgcca tcgcgtcgat tgccgtctca ggactgaatg cggcgacccg ccgtctcgag        60
     gtctcggcca gcaacatcgc caatcagcga tcgaccggag ccctgcccgg cgcggacggc       120
     accgtgccgc cgggcgcgcc acaggcctac aagccgctgc aggtcaacca gaccgacacg       180
     ccgaccggtg gcacacagac cagcctcgcc acgacctcgc ccgccaccgt cccggtgtcc       240
     gatccacaag cgccgttcgc cgatgccgac ggcatggtgg cggcaccgaa cgtcgacctg       300
     gcgcaggaat tcatcggtca gatggtcgcc aaatacagct acacggcgaa cctcgcctcg       360
     ctgcaagccg accgcgacat gaccaaggcg ctgctcgacg cgaaggtgta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page