(data stored in ACNUC30630 zone)

EMBL: CP001096.PE105

CP001096.PE105       Location/Qualifiers
FT   CDS_pept        complement(114274..115254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0105"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mrd:Mrad2831_4763
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98667"
FT                   /db_xref="GOA:B3Q638"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q638"
FT                   /protein_id="ACE98667.1"
FT                   /translation="MALLTHLFGKLANAVALLLAVLVMNFCLIHLAPGDPVQVIAGEMG
FT                   GASPEVIAALRAKYGLDHSLLEQMFTYLGKVAHGDFGYSYYFNQPVLGLILQRLPATLY
FT                   LAAASLVVAVLIGTVLGVISARRPNGLLSHGVTVLSLAGHAAPIFWTGLLLLLLFGSVW
FT                   PILPVNGMTDVVNPKTGFAYAADVAKHLVLPSITLGLVFVAQYSRLARVNMIDVLSADY
FT                   IRTARAKGLPERVVLVKHALRNTLIPIVTVVGLQFGNLFAGAVLVETVYSWPGMGRLVF
FT                   DSILRRDYPTLMGVLFFSAVMVIAANILTDLVYRLIDPRIRAGAR"
     atggctctcc tcacccatct gttcggaaaa ctcgccaacg ccgtcgcgct gctgctggcg        60
     gtgctggtga tgaatttctg cctgatccat cttgcgccgg gcgacccggt gcaggtgatc       120
     gccggcgaga tgggtggggc gtcgcccgag gtgatcgcgg cgctgcgggc aaaatacggc       180
     ctcgaccaca gcctgctcga acagatgttc acttatctgg gcaaggtggc gcatggcgac       240
     ttcggctatt cctactactt caaccagccg gtgctcggcc tgatcctgca gcggctgccc       300
     gcgacgctgt atctggcggc ggcctcgctg gtggtggcgg tgctgatcgg cacggtgctc       360
     ggcgtgatca gcgcccggcg cccgaacggc ctgctcagcc acggcgtcac cgtgctgtcg       420
     ctcgccggtc acgcggcgcc gatcttctgg accggcctgc tgcttctgct gctgttcgga       480
     tcggtgtggc cgatcctgcc ggtcaacggc atgaccgacg tggtcaatcc aaaaaccggc       540
     ttcgcctatg cggccgacgt cgccaagcat ctggtgctgc cgtcgatcac gctggggctg       600
     gtattcgtcg cgcaatattc ccggctcgcc cgcgtcaaca tgatcgacgt gctgtcggcg       660
     gactacatcc gcaccgcgcg cgccaagggg ctgccggagc gggtggtgct ggtcaagcac       720
     gcgctgcgca acacgctgat tccgatcgtc accgtggtcg gcctgcagtt cggcaatctg       780
     ttcgccggcg ccgtgctggt ggagacggtg tactcctggc cgggcatggg gcggctggtg       840
     ttcgactcga tcctgcgccg tgactacccg acgctgatgg gcgtgctgtt cttctccgcc       900
     gtgatggtga tcgcggccaa catcctcacc gacctggtgt accgcctgat cgatccccgt       960
     atccgcgcag gtgcccgatg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page