(data stored in ACNUC30630 zone)

EMBL: CP001096.PE120

CP001096.PE120       Location/Qualifiers
FT   CDS_pept        132295..133356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0120"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: azc:AZC_1833
FT                   dTDP-D-glucose-4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98682"
FT                   /db_xref="GOA:B3Q6Z4"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q6Z4"
FT                   /protein_id="ACE98682.1"
FT                   /translation="MTKRFLVTGGAGFIGSAVVRRLIGTTPHEVLVVDKLTYAGNLDSL
FT                   APVSDDPRFRFVRADIVEQGTMRLLFEEFSPDVVMHLAAESHVDRSIDGPGDFIQTNIV
FT                   GTYSLLQAALAHWRSLPAARKSGFRFHHISTDEVFGSLGAEGLFREDTPYQPKSPYSAS
FT                   KAGSDHLVRAWHHTYGLPVVITNCSNNYGPYHFPEKLIPLAIIKALHGEAIPVYGTGAN
FT                   VRDWLHVEDHADALLLAAERGENGESYNIGGRNERTNLEVVQAICRLLDELAPDAAIGS
FT                   RAKLISFVADRPGHDARYAIDASKVERELGWRARYNFDDGLRQTVQWYLDNRTWWERVR
FT                   SGVYRGERLGVAV"
     atgacaaagc gatttctcgt caccggcgga gccggcttca tcggttctgc ggtggtccgg        60
     cggctgatcg ggaccacccc gcacgaggtg ctggtggtcg acaagctgac ctatgcgggc       120
     aatctcgact cgctagcgcc ggtgtccgac gatccgcgct tccggttcgt ccgagccgac       180
     atcgtcgaac agggcaccat gcggttgctg ttcgaggagt tttcgcccga cgtggtgatg       240
     catcttgccg cggagagcca tgtcgaccgc tcaatcgacg gccccggcga cttcatccag       300
     accaacatcg tcggcaccta ttcgctgctg caggcagctc tggcgcattg gcgttccctg       360
     ccagcggccc gcaagtccgg cttccgcttt caccacatat ctaccgacga ggtattcggt       420
     tcgcttggtg ccgaagggct gttccgggaa gacacgccgt accagccgaa atcgccctac       480
     tccgcctcga aggcggggtc ggaccatctg gtgcgggcct ggcaccacac ctacggcctg       540
     ccggtggtca tcaccaactg ctccaacaat tacggcccct atcacttccc cgaaaagctg       600
     atcccgctgg cgatcatcaa ggcgctgcac ggcgaagcga tcccggtgta cggcacgggc       660
     gccaacgttc gcgactggct gcacgtcgag gatcacgccg atgcgctgct gctcgccgcc       720
     gagcgcggcg agaacggcga aagctataat attggcggtc gcaacgagcg caccaacctc       780
     gaagtcgtgc aggcgatctg ccgactgctc gacgagcttg cacccgatgc ggcgatcgga       840
     tcacgggcaa agctgatcag cttcgtcgcc gaccgtcccg gtcacgacgc ccgctacgcg       900
     atcgatgcga gcaaggtcga gcgcgagctc ggatggcgtg cgcgctacaa tttcgacgac       960
     ggcctgcgcc agaccgtgca gtggtatctc gacaacagga cgtggtggga acgggtccgt      1020
     tcaggcgtgt accgcggcga gcgcctcggc gtggcggtct ag                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page