(data stored in ACNUC30630 zone)

EMBL: CP001096.PE127

CP001096.PE127       Location/Qualifiers
FT   CDS_pept        complement(140704..141528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0127"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bja:bll4141
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98689"
FT                   /db_xref="GOA:B3Q701"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q701"
FT                   /protein_id="ACE98689.1"
FT                   /translation="MKFVVLTDTHFVARGRRIYGLDPAERLSAAVARINREHPDIAFVI
FT                   VTGDLAHWGEEPAYDNLASVLAGLRAPTILMMGNHDKREAFAKFFPGVPRDASGFVQTV
FT                   QVFEAATIVTLDTLNEAAPNHEGLLCEARLAFLEHALAEAPADRPLLLFQHHPPFDTGL
FT                   RYMDTIRLANPDAEWEVIARTRKPDYLFMGHLHRPISGVWRGIPFHIQRGLAHQVAFDL
FT                   VAEGHIPGSHEPPDYAHVSVEADRIVIHQCSFMYDGPLFSLHDSVALHRVSF"
     atgaagttcg tcgttctcac cgatacgcat ttcgtcgccc gcggtcgccg catctacggg        60
     ctcgacccgg ccgaacggct cagtgccgcg gtggcgcgga tcaaccgcga gcatcccgac       120
     atcgctttcg tgatcgtcac cggcgatctg gcgcattggg gcgaggagcc ggcttacgac       180
     aatctggctt cggtgctggc gggattgcgg gcgccgacca tcctgatgat gggcaatcac       240
     gacaagcgcg aggccttcgc caaattcttc cccggcgtgc cgcgcgatgc gagcggcttc       300
     gtccagaccg tgcaggtgtt cgaggcggcg acgatcgtca cgctggacac gctgaacgag       360
     gccgcgccaa accatgaagg gttgttgtgc gaggcgcggc tggcgttcct cgaacacgcg       420
     ctggcggaag ctccggccga ccgtccgctg ctgctgttcc agcatcaccc gccgttcgac       480
     accgggctgc gctacatgga tacgatccgg ctcgccaatc cggacgccga atgggaggtg       540
     atcgcccgca cccgcaagcc ggactatctg ttcatggggc acctgcaccg gcccatctcg       600
     ggcgtgtggc gcggcatccc gtttcacatc cagcgcgggc tggcgcatca ggtcgcgttc       660
     gatctggtgg ccgagggcca catccccggc tcgcacgagc cgccggacta cgcccatgtc       720
     agcgtcgagg ccgatcgcat cgtgatccac cagtgctcgt tcatgtatga cgggccgctg       780
     ttctcgctgc acgacagtgt cgcgctgcac cgcgtctcgt tctga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page