(data stored in ACNUC30630 zone)

EMBL: CP001096.PE13

CP001096.PE13        Location/Qualifiers
FT   CDS_pept        complement(14056..14232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0013"
FT                   /product="cytochrome oxidase maturation protein, cbb3-type"
FT                   /note="TIGRFAM: cytochrome oxidase maturation protein,
FT                   cbb3-type; PFAM: cytochrome oxidase maturation protein
FT                   cbb3-type; KEGG: bra:BRADO2445 nitrogen fixation protein
FT                   FixS"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98575"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK11"
FT                   /protein_id="ACE98575.1"
FT                   /translation="MVILVPLALGLGLLGLVAFLWSLKSGQYEDLDGAAWRAIADDDPP
FT                   LPPPANVPAEKRG"
     atggtgatcc tcgtcccgct ggcgctcggt ctcggcctgc tgggattggt cgcgtttctg        60
     tggtcgctga agagcggcca gtatgaagat ctcgacggag ccgcctggcg agccatcgcc       120
     gacgacgatc cgcccttgcc accgccggcc aatgtgccgg cagaaaagcg aggctga          177
//

If you have problems or comments...

PBIL Back to PBIL home page