(data stored in ACNUC30630 zone)

EMBL: CP001096.PE130

CP001096.PE130       Location/Qualifiers
FT   CDS_pept        complement(143717..144553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0130"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcs:BCAN_B1212 lactose
FT                   transport system permease protein LacG"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98692"
FT                   /db_xref="GOA:B3Q704"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q704"
FT                   /protein_id="ACE98692.1"
FT                   /translation="MSAARPSLIRSSFRHAALMVGAVLMLAPFVWMLSTASKPPEEIYS
FT                   SDLHLIPHHFALWENLRIAFGKADLGRFLLNGVIVTVAIFTCQVLIALPAAYALAKLRF
FT                   LGRKALFALVLFGILIPPQATAIPVFLLLHQLGALDSYAALVLPFTISVFGIFLMRQFF
FT                   MTVPDDLLDAARMDGMSEFAIVWRVMLPTAIPAVTAFGIFSVVAHWNDYFWPLIVLNSQ
FT                   QYYTPPLAVAHFRNAEAGTSYGPLMAAAIVIITPLVVAFLLAQRRFIEGITLTGLK"
     atgagcgccg cacgacccag cctgatccgc tccagcttcc gccacgccgc tctgatggtt        60
     ggcgccgtgc tgatgctggc gccgttcgtc tggatgctgt cgaccgcgtc gaagccgccg       120
     gaagagatct actccagcga cctgcatctg atcccgcatc actttgcgct gtgggagaat       180
     ctccgcatcg cgttcggcaa ggccgatctc ggccgcttcc tgctcaacgg cgtgatcgtc       240
     acggtggcga tcttcacctg ccaggtgctg atcgcgttgc cggccgccta tgcgctcgcc       300
     aagctgcgct tccttgggcg caaggcgctg ttcgcgctgg ttctgttcgg cattctgatc       360
     ccgccgcagg cgaccgcgat cccggtgttc ctgctgctgc accagctcgg ggcgctcgac       420
     agctacgcgg cgctggtgct gccgttcacc atctcggtgt tcggcatctt tctgatgcgg       480
     cagttcttca tgaccgtgcc ggacgatctg ctcgacgccg cccggatgga cgggatgtcg       540
     gagttcgcca tcgtctggcg ggtgatgctg ccgactgcga tccctgcggt caccgcgttc       600
     ggcatcttct cggtggtggc gcactggaac gactacttct ggccgctgat cgtgctcaac       660
     agccagcagt actacacccc gccgctcgcg gtcgcgcatt tccgcaatgc cgaggcgggc       720
     accagctacg gcccgctgat ggcggccgcg atcgtgatca tcaccccgct cgtcgttgcc       780
     ttcctgctgg cgcagcgccg cttcatcgaa ggcatcactt tgaccggact caagtaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page