(data stored in ACNUC30630 zone)

EMBL: CP001096.PE143

CP001096.PE143       Location/Qualifiers
FT   CDS_pept        complement(160253..160741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0143"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: bbt:BBta_7835
FT                   chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98705"
FT                   /db_xref="GOA:B3Q717"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q717"
FT                   /protein_id="ACE98705.1"
FT                   /translation="MAETAQYLTLGLAGETFGMAIRNVREILDMRPISRLPHAPEFMLG
FT                   MIDVRGTGYPILDLRLKLDLPAVPPTEATRIIILDVPVAGRVVGVGFVADCVYEVTDIE
FT                   ESSLEQVPDVGGKWKSDYIAGIGRKGDRFVIIFDLARLMAGTDVSAGAAETPSNDLAA"
     atggccgaaa ccgcgcaata tctgacgctc ggactcgccg gagaaacgtt cggaatggcg        60
     atccgcaacg ttcgcgaaat cctcgatatg cggccgatct cccggctgcc gcacgcgccg       120
     gagttcatgc tcggcatgat cgacgtgcgc ggcaccggtt atccgatcct cgatcttcgg       180
     ctgaagctcg atctgccggc tgtgccgccg accgaggcga cccgcatcat cattctcgac       240
     gtgcccgtcg ccggccgcgt cgtcggcgtc ggcttcgtcg ccgactgtgt ctacgaagtc       300
     accgacatcg aggagagctc gctggagcag gtccccgacg tcggcggcaa gtggaagtcg       360
     gactacatcg ccggcatcgg tcgcaagggc gatcgcttcg tcatcatctt cgatctggcg       420
     cgcctcatgg ccggcaccga cgtgtcggcc ggcgccgccg agaccccatc gaacgacctg       480
     gcggcttga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page