(data stored in ACNUC30630 zone)

EMBL: CP001096.PE148

CP001096.PE148       Location/Qualifiers
FT   CDS_pept        164312..165469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0148"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: response regulator receiver; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; KEGG: bja:bll2340 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98710"
FT                   /db_xref="GOA:B3Q722"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q722"
FT                   /protein_id="ACE98710.1"
FT                   /translation="MLIQALVVDDSRSALDYLKRTIEFDGQVQVIGFTDPVLALASARN
FT                   LDIDIVFADYEMPNMDGISLIRRLRSLPKFSDIPIVMITSIESDEVRLQALDAGATDFL
FT                   PKRPKSLETQVRLRNMIRLGSAVRKLNDRAALLASEVARATHALQEREEEIILRLALSV
FT                   EYRDNDTGDHTLRVAKYSRMIAEGLGLPERLCRDIYLAAPLHDVGKVATPDHILLKPGK
FT                   LTPDEIAVMQTHTTIGASILAGSRCELIQLAADIAIGHHERWDGKGYPNKLKGAEIPIA
FT                   ARIVAVADVFDALATARPYKVAMPLPVARQHLENGRGQHFDPTCVDVFLARWDDVVAIA
FT                   TERLKLQQTHDAPLQPSLPADAQEPTITLPASNRKAGQTGLVPSE"
     atgcttattc aagcactggt tgtggacgat agtcggtccg cgttggatta cttgaagcga        60
     acgatcgaat tcgatggcca ggttcaggtg atcggcttta ccgacccggt gctggccctg       120
     gcatccgccc gcaatctcga catcgacatc gtcttcgccg actatgaaat gccgaatatg       180
     gacggcatca gcctgatccg cagacttcgg tcgctgccga aattctccga cattccgatc       240
     gtgatgatca cctcgatcga gagcgacgag gtacggctgc aggcgctcga cgccggcgcg       300
     accgacttcc tgccgaagcg gcccaagagc ctggagaccc aggtccggct gcgcaacatg       360
     atccggctgg gctccgcggt tcgcaagctg aacgaccgcg ccgcgctgct ggcgagcgag       420
     gtggcgcgcg ccactcacgc gctgcaggag cgggaggaag agatcattct tcggctggcg       480
     ctgtcggtcg agtatcgcga caacgacacc ggcgatcaca ccctcagggt tgcaaaatac       540
     agccggatga tagcggaagg gttgggactg ccggaaaggc tgtgccgcga catctatctg       600
     gccgccccgc tgcacgatgt cggcaaggtc gccacgcccg accatattct cctcaagccg       660
     ggcaagctga cgccggacga gatcgccgtg atgcagactc acaccacgat cggcgcatcg       720
     atcctcgccg gcagccgatg cgaactcatt cagctcgccg ccgacatcgc gatcggccat       780
     cacgagcggt gggacggcaa aggctacccg aacaaactga agggtgccga gattccgatc       840
     gcggcccgaa tcgtcgcagt cgccgacgtg ttcgatgcgc tggcgaccgc gcgtccatat       900
     aaagtcgcca tgccgctccc ggtggcgcgg cagcacctcg aaaacgggcg cgggcagcac       960
     tttgatccga cctgcgtcga cgttttcctg gcgcgctggg acgacgtcgt cgcaattgcc      1020
     accgagcgat tgaagcttca gcagacgcac gacgcgccgc tgcagccatc actccccgcg      1080
     gacgctcagg agccgacgat cacactgccg gcgtcgaatc ggaaagcggg ccaaacgggc      1140
     ctggtcccgt ccgaatag                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page