(data stored in ACNUC30630 zone)

EMBL: CP001096.PE152

CP001096.PE152       Location/Qualifiers
FT   CDS_pept        168243..168515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0152"
FT                   /product="ribosomal protein L27"
FT                   /note="PFAM: ribosomal protein L27; KEGG: nha:Nham_0515 50S
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98714"
FT                   /db_xref="GOA:B3Q726"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q726"
FT                   /protein_id="ACE98714.1"
FT                   /translation="MAHKKAGGSSRNGRDSAGKRLGVKAFGGEHVIPGNIIARQRGTQW
FT                   HPGLNVGMGTDHTLFAKVEGRVEFRAKANGRTYVSVLPIAMQAAE"
     atggctcata aaaaggcggg cggttcctcg cgcaacggac gtgattccgc aggcaagcgc        60
     ctcggcgtga aggcgtttgg cggcgagcac gtgattcccg gcaacatcat tgcgcgtcag       120
     cgcggcactc agtggcatcc cggcctcaac gtcggcatgg gcactgatca caccttgttc       180
     gccaaggtcg aaggccgcgt cgaattccgc gccaaagcca acggccgcac ctacgtatcg       240
     gtactcccga ttgcgatgca ggcggccgaa tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page