(data stored in ACNUC30630 zone)

EMBL: CP001096.PE16

CP001096.PE16        Location/Qualifiers
FT   CDS_pept        complement(16985..18442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0016"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="TIGRFAM: cytochrome c oxidase accessory protein
FT                   CcoG; KEGG: bbt:BBta_2795 nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98578"
FT                   /db_xref="GOA:B3QK14"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK14"
FT                   /protein_id="ACE98578.1"
FT                   /translation="MNKPLRATDLQPDDDGPLYTAQKKIFPQSVSGPFRRIKWILMAVC
FT                   LGIYYFLPFVRWNRGLGAPDQAVLIDLANNRFYFFAIELWPQEIYYFTGLLIVAAIVLF
FT                   LMNALGGRVWCGYLCPQTVWTDLFYAVERFVEGDRRERMRKAGEGFKMQRAAELALKHS
FT                   IWLMIAWWTGGAWVLYFADAPTLIKELVTFDAPMVAYIWIGILTFTTYTLAGFMREQVC
FT                   VYMCPWPRIQAALTDEWALNVTYKYDRGEKRSSLKKAAQLRALGEPVGDCVDCNQCVAV
FT                   CPTGIDIRNGPQLDCIQCGLCIDACDNVMTKIGRPTRLIGYDNDINIHRRMEGKPEIFK
FT                   PVRARTVIYSLIIVAIGGAMLYKLATRSLLDVNVLHDRNPVAVRLSDGSVRNGYTIRFL
FT                   NKRGFDRVVAVDVEGPPNAMIHIVGADSITPARPMIILGRDTTTELRVLVDSNTNDDVP
FT                   QSVPVTFHVTDIGLGEVASTKDVFVTP"
     atgaataagc ccctgcgcgc gacggacctg cagccggacg acgacggccc gctgtacacg        60
     gcccaaaaga aaatcttccc ccaaagcgtg tccggcccgt tccggcgaat caaatggatc       120
     ctgatggcgg tctgcctcgg gatctattac tttttgccct tcgtgcgatg gaaccgcggt       180
     ctcggcgcgc ccgatcaggc ggtgctgatc gacctcgcca acaaccggtt ctacttcttc       240
     gccatcgaac tgtggccgca ggaaatctat tacttcaccg gcctgttgat cgtcgccgcc       300
     atcgtgctgt tcctgatgaa cgccctcggc ggccgggtat ggtgcggtta tttgtgcccg       360
     cagacggtct ggaccgatct gttctacgcg gtcgaacggt tcgtcgaagg cgatcgacgc       420
     gagcggatgc gcaaggccgg cgaaggcttc aagatgcagc gcgcagcgga actcgcgctc       480
     aagcactcga tctggctgat gatcgcgtgg tggaccggcg gcgcctgggt tctgtacttc       540
     gccgacgctc cgaccctgat caaggaactg gtcaccttcg atgcgccgat ggtggcgtat       600
     atctggatcg gcatccttac cttcaccacc tacacgctgg ccggcttcat gcgcgagcag       660
     gtctgcgtct acatgtgccc gtggccccgc attcaggcag cgctgaccga cgaatgggcg       720
     ctcaacgtca cctataagta cgatcgcggc gagaagcgtt cgtcgctcaa gaaggcggct       780
     cagctccggg cgctcggtga gccggtcggc gattgcgtcg actgcaacca gtgcgtggcc       840
     gtctgcccaa ccggcatcga catccgcaac ggaccgcagc tcgactgcat ccagtgcggc       900
     ctgtgcatcg acgcctgcga caatgtgatg acgaagatcg gtcgtccgac ccggctgatc       960
     ggctacgaca acgacatcaa catccatcgc cggatggagg gcaagccgga gatcttcaag      1020
     ccggtccgcg cccgtaccgt gatctactcg ctgatcatcg tcgcgatcgg tggtgcgatg      1080
     ctgtacaagc tggcgacccg cagcctgctc gacgtcaacg tcctgcacga ccgcaacccg      1140
     gtcgcggtgc ggctgtcgga cggatcggtg cgtaacggct acaccatccg cttcctcaac      1200
     aagcgcggct tcgaccgcgt ggtggcggtc gacgtcgaag gtccgccgaa tgcgatgatc      1260
     cacatcgtcg gtgcggactc gatcacgccg gcccggccaa tgatcatcct cggccgcgac      1320
     accaccaccg agctgcgggt gctggtcgac tccaacacaa acgatgacgt gccgcaatcg      1380
     gtgccggtga ctttccatgt caccgatatc gggctgggtg aggtcgcctc caccaaggac      1440
     gtctttgtta cgccctga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page