(data stored in ACNUC30630 zone)

EMBL: CP001096.PE164

CP001096.PE164       Location/Qualifiers
FT   CDS_pept        178140..179516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0164"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: bja:blr0434 carboxy-terminal protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF
FT                   domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98726"
FT                   /db_xref="GOA:B3Q738"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q738"
FT                   /protein_id="ACE98726.1"
FT                   /translation="MMRKTSVILLSAVTGAALTLFVTQPRTMLMGATARAATSDTYRQL
FT                   NLFGDVFERVRSDYVEKPDDSKLVESAISGMLAGLDPHSSYMDAKSFRDMQVQTRGEFG
FT                   GLGIEVTMEDGLIKVVSPIDDTPASKAGILANDIITNLDDEAVQGLTLNQAVEKMRGPV
FT                   NTKIRLKIVRKGQDNPIEVTLVRDNIRVRSVRARVEDSDIGYIRITTFNEQTTEGLKKE
FT                   IANLTNQIGADKLKGFILDLRNNPGGLLEEAVTVSDAFLDRGEIVSTRGRNAEETQRRS
FT                   AHAGDLTKGKPVIVLINGGSASASEIVAGALQDHKRATVVGTRSFGKGSVQTIIPLGSG
FT                   NGALRLTTARYYTPSGKSIQAKGITPDIEVMQDVPADLKARTDTKGEASLRGHLKGADG
FT                   DEKTGSQSYVPPEAKDDKALKAAADLLHGIKVNASAPADKQTTGDKAAIDKPAGNKAAN
FT                   "
     atgatgcgca agacttcggt aatcctcctc agcgccgtca ccggtgccgc gctgacactt        60
     ttcgtcaccc aacctcgcac gatgctgatg ggcgccaccg cccgcgccgc cacctccgac       120
     acctaccgcc agctcaacct gttcggcgac gtgttcgagc gcgtgcgcag cgactacgtc       180
     gagaagccgg acgactccaa actggtcgaa tccgccatca gcggcatgct ggccggactc       240
     gatccgcatt ccagctacat ggatgccaag agcttccgtg acatgcaggt gcagacccgc       300
     ggcgaattcg gtggtctcgg catcgaagtc acgatggaag acggcctgat caaggtggtg       360
     tcgccgatcg acgatacgcc tgcgtcgaag gccggcattc tggctaacga catcatcacc       420
     aatctcgacg acgaggcggt gcagggcctg accctgaacc aggcggtcga gaagatgcgc       480
     ggtccggtca acaccaagat ccggctgaag atcgtccgca agggccagga caacccgatc       540
     gaagtcacgc tggtacgcga caacatccgc gtccgctcgg tgcgcgcgcg cgtcgaagac       600
     agcgacatcg gctacatccg catcacgacc ttcaacgagc agaccaccga agggctcaag       660
     aaggagattg cgaacctgac caaccagatc ggcgccgaca agctgaaggg cttcatcctc       720
     gatctgcgca acaacccggg cggtctgctc gaggaagccg tgacggtgtc ggacgcgttc       780
     ctggatcgcg gcgagatcgt ctcgactcgc ggccgcaacg ccgaagagac ccagcgccgc       840
     tccgcgcatg cgggcgacct caccaagggc aagccggtga tcgtgctgat caacggcggc       900
     tcggcctcgg cgtcggaaat cgtcgccggt gcgctgcagg atcacaagcg cgccaccgtg       960
     gtcggcaccc gttcgttcgg taagggctct gtgcagacca tcatcccgct cggctccggc      1020
     aacggcgcgc tgcggctgac cacggcgcgc tactacacgc cgtccggcaa gtcgatccag      1080
     gccaagggca tcacgccgga tatcgaagtg atgcaggacg tgccggccga cctcaaggcg      1140
     cggaccgaca ccaagggcga agcctcgctg cgcggccatc tgaagggcgc cgacggcgac      1200
     gagaagaccg gctcgcagtc ctacgtgccg ccggaagcca aggacgacaa ggcgctgaag      1260
     gccgcggccg atctgctgca cggcatcaag gtcaacgctt cggccccggc cgacaagcag      1320
     accaccggcg acaaggcggc gatcgacaag ccggccggca acaaggcggc gaactga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page