(data stored in ACNUC30630 zone)

EMBL: CP001096.PE165

CP001096.PE165       Location/Qualifiers
FT   CDS_pept        179667..180905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0165"
FT                   /product="protein of unknown function DUF610 YibQ"
FT                   /note="PFAM: protein of unknown function DUF610 YibQ; KEGG:
FT                   nha:Nham_0526 protein of unknown function DUF610, YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98727"
FT                   /db_xref="GOA:B3Q739"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q739"
FT                   /protein_id="ACE98727.1"
FT                   /translation="MAADELSTPLGQKRNRWQRLRHYRLPFNATQGIAALLGLFVLTFL
FT                   GFALFGNDPFGGEPVVRVEIKASPDEAKQAAAEAGKDQGGKPENAAAAGAEKKDAEPKE
FT                   AAAGQKTITIIDGSKGTRQDVVVGTDSPDKAEPPAGPTTSDGINPKLLEQSRYGMIPVM
FT                   AGGLKPFSAYAMTTDADRAKAERMPTVTIVVGGLGIGAARTNDAVMKLPAAVALAFTPY
FT                   GSDPGKLATEARAKRHEVILQIPMEPFDYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRI
FT                   QGYVGLSNFMGARFVATEPAMQAIIRDAAKRGLGYLDDGTAPRSVAGTLAKSLAIPFAR
FT                   ADLTIDQVPAGADIDKSLARLESIAKERGSAVGMASALPVTIERIVNWSKSLESRGILL
FT                   APLTTAMLKSKSS"
     gtggcggcgg acgaactaag caccccgctg ggtcagaagc ggaaccggtg gcagcggctg        60
     cgccactacc ggctgccgtt caacgccacc caggggatcg cggcccttct cggcctattc       120
     gtgctgacgt tcctcggctt cgcgctgttc ggcaatgatc cgttcggcgg cgagccggtg       180
     gtgcgggtcg agatcaaggc aagccccgac gaggcgaagc aggccgccgc cgaggccggc       240
     aaggatcaag gcggcaaacc cgagaatgct gcggcggcgg gcgccgagaa gaaggacgcc       300
     gaaccgaagg aagcggccgc cgggcagaag accatcacca tcatcgacgg ctccaagggc       360
     acgcgccagg acgtcgtggt cggcaccgac agccccgaca aggcggagcc tccagcagga       420
     ccgacgacct cagacggcat caacccgaag ctgctggaac agtcgcgcta cggcatgatc       480
     ccggtgatgg cgggcgggct gaagccgttc tcggcctatg cgatgacgac tgacgccgat       540
     cgcgccaagg ccgagcggat gccgaccgtg acaatcgtgg tcggcgggct cgggatcggc       600
     gcggcgcgca ccaacgatgc agtgatgaag ctgccggccg cggtggcgtt ggccttcacc       660
     ccgtatggat cggacccggg aaagcttgcg accgaagcgc gggccaagcg ccacgaggtc       720
     attctgcaga tcccgatgga gccgttcgat tatcccgaca acgaccccgg accgcagacg       780
     ctgctgacct ccagcgcgcc ggagcagaat ctcgaccggc tgaattggca tctcagccgg       840
     atccagggct atgtcggcct gtcgaatttc atgggcgcgc ggttcgtcgc caccgagccg       900
     gcgatgcagg cgatcatccg cgacgccgcc aagcgcggtc tcggctatct cgacgacggc       960
     accgccccgc gcagcgtcgc cggaacgctg gcgaagtcgc tggcgatccc gttcgcgcgg      1020
     gccgacctca cgatcgacca ggtgccggcc ggcgccgaca tcgacaagtc gctggcgcgg      1080
     ctcgagagca tcgccaaaga gcggggcagc gctgtcggca tggcttctgc gcttccggtg      1140
     acgattgaac gaattgtcaa ctggagcaag agcttggaga gtcgggggat cctcctggcg      1200
     ccattgacaa cggcgatgct gaaatcaaaa tcaagttga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page