(data stored in ACNUC30630 zone)

EMBL: CP001096.PE173

CP001096.PE173       Location/Qualifiers
FT   CDS_pept        complement(187660..189192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0173"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.4.21.68"
FT                   /note="KEGG: nha:Nham_0532 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98735"
FT                   /db_xref="GOA:B3Q747"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q747"
FT                   /protein_id="ACE98735.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVSEVGQVLSVGDGIARVYGLD
FT                   NVLAGEMVEFENGTRGMALNLETDNVGVVIFGADREIKEGQTVKRTRSIVDAPVGKGLL
FT                   GRVVDALGNPIDGKGPIQAVERKRVDVKAPGIIPRKSVHEPMATGLKSIDALIPIGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNVEGAPESQKLYCVYVAVGQKRSTVAQFVKVLE
FT                   EQGALEYSVVVAATASDPAPMQYIAPFTGCTIGEYFRDNGMHAVIIYDDLSKQAVAYRQ
FT                   MSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNDEQGNGSLTALPVIETQANDVSAYIP
FT                   TNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYR
FT                   EMAAFAQFGSDLDAATQRLLNRGSRLTELLKQPQFSPLKMEEQVCVIWAGTNGYLDALP
FT                   LNKVRAFEDGLLALLRGKESGILEAIRTSRDLSDDTAAKLKAVVESYAKTFA"
     atggacatcc gcgccgcgga aatttccgcg atcctcaagg accagatcaa gaatttcggc        60
     caggaagccg aagtctccga ggtcggacag gtgttgtccg tcggcgacgg tatcgcccgc       120
     gtttatggcc tggataacgt gctcgccggt gaaatggtcg agttcgagaa cggcacccgc       180
     ggcatggcgc tgaacctcga aaccgacaac gtcggcgtcg tgatcttcgg tgccgaccgc       240
     gagattaagg aaggccagac cgtcaagcgc acccgttcga tcgtggacgc gccggtcggc       300
     aagggtctgc tcggccgcgt cgtcgacgcg ctgggtaacc cgatcgacgg caagggtccg       360
     atccaggcgg tcgagcgcaa gcgcgtcgac gtcaaggcgc ccggcatcat tccgcgcaag       420
     tcggtgcacg agccgatggc gaccggcctg aagtcgatcg acgcgctgat cccgatcggt       480
     cgtggccagc gcgagctgat catcggcgac cgtcagaccg gcaagaccgc gatcgcgctc       540
     gacaccattc tgaaccagaa gccgctgaac gtcgaaggcg cgccggagag ccagaagctc       600
     tactgcgttt acgtcgcggt cggtcagaag cgctccaccg tcgcccagtt cgtcaaggtt       660
     ctggaagagc agggcgcgct ggaatactcg gtcgtcgtcg ccgctaccgc gtcggacccg       720
     gctccgatgc agtacatcgc gccgttcacc ggctgcacca tcggcgagta cttccgcgac       780
     aacggcatgc acgccgtcat catctatgac gacttgtcca agcaggccgt cgcttatcgt       840
     cagatgtcgc tgttgctgcg ccgcccgccg ggccgcgaag cgtatccggg cgacgtgttc       900
     tacctgcact cccgtctgct cgagcgcgcc gccaagctca atgacgagca gggcaacggc       960
     tcgctcaccg cgctgccggt gatcgaaact caggccaacg acgtctcggc ctacattccg      1020
     accaacgtga tctcgatcac cgacggccag atcttcctgg aaaccgacct gttcttccag      1080
     ggcatccgcc cggccgtgaa cgtcggtctg tcggtgtcgc gcgtcggttc gtcggcgcag      1140
     accaaggcga tgaagaaggt cgccggcaag atcaagggcg agctcgcgca gtaccgcgaa      1200
     atggcggcgt tcgcgcagtt cggctccgac ctcgacgccg cgacccagcg cctgctgaac      1260
     cgcggttcgc gcctgaccga actcctgaag cagccgcagt tctcgccgct gaagatggaa      1320
     gagcaggtct gcgtgatctg ggccggcacc aacggctatc tcgatgcgct gccgctcaac      1380
     aaggtgcgcg cgttcgaaga cggcctgctg gcgctgctgc gcggcaagga gtcgggcatc      1440
     ctggaagcga tccgcaccag ccgcgatctt tccgatgaca ccgctgcgaa gctcaaggcg      1500
     gtggtcgaaa gctacgccaa gacgttcgct tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page