(data stored in ACNUC30630 zone)

EMBL: CP001096.PE174

CP001096.PE174       Location/Qualifiers
FT   CDS_pept        complement(189192..189752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0174"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: nwi:Nwi_0429 F0F1 ATP synthase subunit delta;
FT                   TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98736"
FT                   /db_xref="GOA:B3Q748"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q748"
FT                   /protein_id="ACE98736.1"
FT                   /translation="MASEDPSVSGVSGRYATALFELARDEKSIDAVTADLDKFSAMLAG
FT                   SPDLVRLVRSPVFASEVQGKALAAVLDKAGITGISANFLKVLAANRRLFVVADVIRAYR
FT                   ALVAKFKGEATADVTVAEKLSDKNLEALKAALKSVTGKDVALNINVDPAIIGGLVVKLG
FT                   SRMVDSSLRTKLNSIKHAMKEAG"
     gtggcatctg aagatccatc ggtttccgga gtctccggtc gttacgcgac cgctttgttt        60
     gaactggccc gcgacgagaa atccatcgat gcggtgacgg ccgatctgga caagttcagc       120
     gccatgctgg cgggcagccc cgatctggtt cgcctggtcc gcagtccggt gttcgcctcc       180
     gaggtgcagg gcaaggcgct ggccgcagtg ctcgacaagg cgggcatcac tggcatcagc       240
     gccaattttc tgaaagtgct cgcggccaac cgccggctgt tcgtggtcgc agacgtgatc       300
     cgcgcctatc gcgcgctggt cgccaagttc aagggtgagg cgaccgccga cgtgaccgtg       360
     gccgagaagc tcagcgacaa gaatctcgaa gcgctgaagg cggcgctgaa gtcggtgacc       420
     ggcaaggacg tcgccctcaa tatcaatgtc gatccggcga tcatcggcgg gcttgtcgtc       480
     aagctcggta gccgcatggt cgacagttcg ctccgcacca aactcaattc gatcaagcac       540
     gcgatgaaag aggcaggctg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page