(data stored in ACNUC30630 zone)

EMBL: CP001096.PE181

CP001096.PE181       Location/Qualifiers
FT   CDS_pept        complement(197277..198023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0181"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bbt:BBta_0397 putative oxidoreductase
FT                   (YgfF), NAD(P)-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98743"
FT                   /db_xref="GOA:B3Q755"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q755"
FT                   /protein_id="ACE98743.1"
FT                   /translation="MNDRVVIITGGSRGIGRATALGCAKRGFKVVVGYASNAAAADEVV
FT                   AEIAASNGKAIAVKCDVGSEADILALFAAADAFGPLGALVNNAGIVGPTARVDEMSAER
FT                   IQRMMAVNVTGSILCAREAVKRMSTRHGGKGGVIVNLSSVAAKLGSPNTYVDYAASKGA
FT                   VDSFTVGLGHEVAGEGIRVAAIRPGLIDTEIHASGGDPERAHRLSVNVPMKRVGRAEEI
FT                   ANAVVWLLSDEASYVTSAIIDVSGGR"
     atgaacgatc gcgtcgtcat catcaccgga ggcagccgcg gcatcggccg ggccactgcg        60
     ctgggttgtg cgaagcgcgg cttcaaggtc gtggtcggct acgccagtaa tgccgccgcg       120
     gccgacgagg tggtggccga gatagcagcc agcaatggca aggctatcgc ggtgaaatgc       180
     gacgtcggca gcgaagccga cattctcgcg ctgttcgctg ccgcggacgc gttcggtccg       240
     ctcggcgcgc tggtcaataa tgctggcatc gtcggaccga ccgcgcgggt cgacgagatg       300
     tcggccgaac gcattcagcg gatgatggcg gttaacgtca ccggcagcat tctgtgcgcg       360
     cgtgaggcgg tgaagcggat gtcgacccgg cacggcggta agggcggcgt catcgtcaat       420
     ctgtcatcgg tcgcggccaa actcggctcg ccaaatacct atgtcgacta cgcggcctcc       480
     aagggtgcgg tcgactcctt cacggtcggg ctcggccacg aagtcgccgg cgaaggcatt       540
     cgcgtcgcgg cgatccggcc tggattgatc gataccgaga tccacgcctc gggcggcgat       600
     ccggaacgcg cgcatcggct cagcgtcaac gtgccgatga agcgcgtcgg ccgcgccgag       660
     gaaatcgcca acgccgtcgt ctggctgctg tccgacgagg cctcctatgt caccagcgcc       720
     atcatcgacg tgtcgggggg acgatag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page