(data stored in ACNUC30630 zone)

EMBL: CP001096.PE182

CP001096.PE182       Location/Qualifiers
FT   CDS_pept        complement(198031..198432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcs:BCAN_A1965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98744"
FT                   /db_xref="GOA:B3Q756"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q756"
FT                   /protein_id="ACE98744.1"
FT                   /translation="MPPMPTEITVLGWSVVLLIVQMFLASIPTTMELGGDYQAGPRDEP
FT                   RTPTGRFAGRANRAFRNLLETYPAFVGLALALAITGKAGGYAATASVVWLIARALYAPL
FT                   YIIEIPFARSIVWFVSLLALIAMLVRLLS"
     atgccgccga tgccgaccga gatcacggtg ctgggctgga gcgtggtgct gctgatcgtg        60
     cagatgttcc tggcttccat cccgaccacc atggagctag gcggcgacta tcaggcgggt       120
     ccccgagacg agccacgaac gccgacgggg cggtttgccg gccgcgccaa ccgggccttc       180
     cgcaatctgc tcgaaaccta tccggcgttc gtcggtctgg cgctggcttt ggcgatcacc       240
     ggcaaggcgg gcggctacgc tgccacggcc tcggtggtct ggctgatcgc ccgcgcattg       300
     tatgcgccgc tgtacatcat cgaaatcccg ttcgcccgca gcattgtctg gttcgtgtcg       360
     ctgttggcgc tgatcgcgat gctggtccgg ctattgagtt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page