(data stored in ACNUC30630 zone)

EMBL: CP001096.PE185

CP001096.PE185       Location/Qualifiers
FT   CDS_pept        complement(202934..203818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0185"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: bbt:BBta_0394 succinyl-CoA
FT                   synthetase, alpha subunit, NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98747"
FT                   /db_xref="GOA:B3Q759"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q759"
FT                   /protein_id="ACE98747.1"
FT                   /translation="MSILIDSNTRVICQGFTGKNGTFHSEAAIAYGTKMVGGTSPGKGG
FT                   STHLGLPVFDTVREARDKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLD
FT                   MVRVKRSLNGSKSRLIGPNCPGVMTAGECKIGIMPANIFKPGSVGIVSRSGTLTYEAVF
FT                   QTSAEGLGQTTAVGIGGDPVKGTEFIDVLEMFLADDKTESIIMIGEIGGSAEEDAAQFL
FT                   IDEAKRGRKKPMVGFIAGVTAPPGRRMGHAGAIISGGKGDAASKTAAMEAAGITVSPSP
FT                   ARLGKTLAEKLKS"
     atgtccattc tgatcgacag caacacccgc gttatctgcc agggcttcac cggcaagaac        60
     ggtaccttcc attccgaggc agcgatcgcc tacggcacca agatggtcgg cggcacctcg       120
     ccgggcaaag gcggctcgac ccacctcggc ctgccggtgt tcgacaccgt ccgtgaggcg       180
     cgcgacaaga ccggggcgga tgcgtcggtg atctacgtgc cgccgccggg cgccgcggac       240
     gcgatctgcg aggcgatcga cgccgagatc ccgctgatcg tctgcatcac cgagggcatc       300
     ccggtgctcg acatggtgcg ggtgaagcgg tcgctgaatg gctcgaagtc gcgcctgatc       360
     gggccgaact gcccgggcgt gatgaccgcc ggcgagtgca agatcggcat catgccggcc       420
     aacatcttca agccgggctc ggtcggcatc gtgtcgcgct ccggcaccct gacctatgag       480
     gcggtgttcc agacctcggc cgagggcctc ggccagacca ccgcggtcgg catcggcggc       540
     gacccggtca agggcaccga attcatcgac gtgctggaga tgttcctggc cgacgacaag       600
     accgagtcga tcatcatgat cggtgagatc ggcggttcgg ccgaagaaga cgccgcccag       660
     ttcctgatcg acgaggccaa gcgcggccgc aagaaaccga tggtcggatt catcgccggc       720
     gtcactgccc ctcccggccg ccgcatgggc cacgccggtg cgatcatttc gggcggcaag       780
     ggcgatgcgg cctcgaagac cgcagccatg gaagcggctg gcatcaccgt gtcgccgtcg       840
     ccggcgcgtc ttggcaaaac gcttgccgaa aagttgaagt cctaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page