(data stored in ACNUC30630 zone)

EMBL: CP001096.PE186

CP001096.PE186       Location/Qualifiers
FT   CDS_pept        complement(203883..205079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0186"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: bra:BRADO0404 succinyl-CoA synthetase subunit
FT                   beta; TIGRFAM: succinyl-CoA synthetase, beta subunit; PFAM:
FT                   ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98748"
FT                   /db_xref="GOA:B3Q760"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B3Q760"
FT                   /protein_id="ACE98748.1"
FT                   /translation="MNIHEYQAKAVLREFGVPVGHGFPIFKASEAEAAAKQLGGPVWVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVKEFAKQMLGATLVTVQTGADGKQVN
FT                   RLYIEEGSDIDKEFYLSLLVDRATSRISFVVSTEGGMSIEDVAHETPEKIVSFTVDPAT
FT                   GIMGHHGRTVAKALNLKGEQAKQAEAMVAKLYTAFVAKDMDMLEINPLVLTKQGDLKCL
FT                   DAKISFDGNALYRHTDIQALRDETEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMA
FT                   TMDIIKLYGMSPANFLDVGGGASKEKVTAAFKIITADPNVKGILINIFGGIMKCDVIAE
FT                   GVVAAVKEVGLDVPLVVRLEGTNVEAGKKIIKHSGLNVLPADNLDDAAQKIVAAVKGA"
     atgaatattc acgaatacca ggccaaggcg gtgctgcgcg agttcggtgt gccggtgggg        60
     cacggcttcc cgatcttcaa ggcgtccgaa gcggaagccg ccgccaagca gctcggcggc       120
     ccggtctggg tggtgaagag ccagatccac gccggcggcc gcggcaaggg caagttcaag       180
     gaagcttccg ccggcgacaa gggcggcgtt cgcctcgcca agtcgatcga cgaggtcaag       240
     gaattcgcca agcagatgct cggcgccacg ctggtgacgg tgcagacggg cgccgacggc       300
     aagcaggtca accgcctgta catcgaggaa ggctccgaca tcgacaagga gttctacctg       360
     tcgttgctgg tcgatcgcgc cacctcgcgg atttccttcg tggtctcgac cgaaggcggc       420
     atgtcgatcg aagacgttgc ccacgagacg cccgagaaga tcgtgtcgtt caccgtcgat       480
     ccggcgaccg gcatcatggg ccatcacggc cgcaccgtcg ccaaggcgct gaacctcaag       540
     ggcgagcagg ccaagcaggc cgaagcgatg gtggcgaagc tttacaccgc cttcgtcgcc       600
     aaagacatgg acatgctcga gatcaacccg ctggtgctga ccaagcaggg cgatctgaag       660
     tgcctcgacg ccaagatctc gttcgacggc aacgcgctgt accgccacac cgacatccag       720
     gcgctgcgtg acgagaccga ggaagacgcc aaggaaatcg aagcgtcgaa atacgacctc       780
     aactacgtca ccctcgacgg caccatcggc tgcatggtca acggcgccgg cctcgcgatg       840
     gcgacgatgg acatcatcaa gctgtacggc atgagcccgg ccaacttcct cgacgtcggc       900
     ggcggcgcca gcaaggagaa ggtgaccgcg gcgttcaaga tcatcactgc cgatccgaac       960
     gtgaagggca tcctgatcaa catcttcggc ggcatcatga agtgcgacgt gatcgccgaa      1020
     ggcgtggtcg cagcggtcaa ggaagtcggt ctcgacgtgc cgctggtggt ccgcctcgaa      1080
     ggcaccaatg tcgaagctgg caagaagatc atcaagcatt ccggcctcaa cgtgctgccc      1140
     gccgacaatc tcgacgacgc cgcgcagaag atcgtcgccg ccgtgaaggg agcctga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page