(data stored in ACNUC30630 zone)

EMBL: CP001096.PE196

CP001096.PE196       Location/Qualifiers
FT   CDS_pept        complement(217221..217976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0198"
FT                   /product="protein of unknown function DUF1223"
FT                   /note="PFAM: protein of unknown function DUF1223; KEGG:
FT                   nha:Nham_0407 protein of unknown function DUF1223"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98758"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q770"
FT                   /protein_id="ACE98758.1"
FT                   /translation="MNGVGGFSRWSGALGLCVTIATADLAAAEPRAVVELFTSQGCSSC
FT                   PPADRIIGELARDPSVIALSLPIDYWDYLGWKDTLADSRFTARQKAYSQVRGDRDVFTP
FT                   QVVVNGSAHLVGSNRAGIDSAIKTTDKTGGVMTVPVSVAVEGKEIKVSVAAAPQGETAK
FT                   SGEVWICAVSKAIPIEIGRGENRGRHVTYHNVVRNLLKVGDWTGAAEHWTVPLENVVGD
FT                   GVDAAAVYVQNGSREKPGAMLGAAFTSLN"
     atgaatggtg ttggtggatt ttcgcggtgg tccggcgcac tcggcctgtg cgtgacgatc        60
     gcgacggcgg accttgctgc cgccgagccc cgcgccgtgg tcgagctgtt cacctcgcaa       120
     ggttgttcgt cctgtccgcc ggcggacagg atcatcggtg aacttgcacg tgatccatcg       180
     gtgatcgccc tgagcctccc gatcgactac tgggactatc tcggctggaa agacaccttg       240
     gccgactccc gttttaccgc tcgacagaaa gcctactcgc aagtgcgagg cgatcgggac       300
     gtgttcaccc cacaggtcgt cgtcaacggg tcggcgcacc tcgtcggcag caatcgcgcc       360
     ggcatcgaca gcgcgatcaa gaccaccgac aagaccggcg gagtcatgac cgtgccggtc       420
     tcggtggcgg tcgagggcaa agaaatcaaa gtctcggtcg cagcggcgcc ccagggcgag       480
     accgccaaga gcggcgaggt ctggatttgc gcggtgtcca aagcgattcc gatcgagatc       540
     gggcgcggcg agaaccgcgg ccggcacgtc acctaccaca acgtagtgcg caatctgctg       600
     aaggtcggcg attggaccgg tgcggcagag cattggacgg tgccgctgga gaatgtcgtc       660
     ggcgacggcg tcgatgcggc ggcggtctat gtgcagaacg gtagccgcga aaagcccggt       720
     gcgatgctcg gggccgcctt cacgtcgctg aactaa                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page