(data stored in ACNUC30630 zone)

EMBL: CP001096.PE2

CP001096.PE2         Location/Qualifiers
FT   CDS_pept        1872..2990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: nha:Nham_0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98564"
FT                   /db_xref="GOA:B3QK00"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B3QK00"
FT                   /protein_id="ACE98564.1"
FT                   /translation="MKVTVERAQLLKSLSHVHRVVERRNTIPILGNVLVRAENAQLALK
FT                   ATDLDLEVTETLPAETATAGSTTVPAHMFYDIVRKLPDGSQIVLESDGDRSVLAIRAGR
FT                   SRFTLQTLPESDFPDLAAGEMSHAFRLPASDVKRLIDRTQFAISTEETRYYLNGIYLHT
FT                   AGSPKASSLRAVATDGHRLAQLDLTLPSGADGMPGLIVPRKTVGEVQRLIEDTEAEIGI
FT                   ELSTGKIRFTLGNVVLTSKLIDGTFPDYGRVIPQNNDKELRVDKKDFEAAVDRVSTISS
FT                   ERGRAVKLALSAGKLVLSVTNPDSGSATEELEVEYASDPLDIGFNSRYLLDIAAQIEGE
FT                   VAVLKLADPGSPTLIQDRDSKSALYVLMPMRV"
     atgaaggtca cggtcgaacg cgcgcaactg ttgaagtcgc tgagccacgt gcatcgcgtg        60
     gtcgagcgcc gcaacaccat cccgatcctc ggcaacgtgc tggtgcgagc cgagaacgcg       120
     cagctcgcgc tgaaggcgac cgacctcgac ctcgaggtca ccgagacgtt gccggccgaa       180
     accgcgaccg cgggttcaac aaccgtcccg gcgcacatgt tctacgacat cgtccgaaag       240
     ctgccggacg gctcgcagat cgtgctcgaa agtgacggcg atcgttcggt gctggcgatc       300
     cgcgccggcc gctcgcggtt cacgctgcag acgctgccgg agagcgactt cccggatctc       360
     gccgccggcg agatgagcca cgccttccgc ctgccggcct ccgacgtcaa gcggctgatc       420
     gatcgcaccc agttcgcgat ctcgaccgaa gagacccgct actatctcaa cggtatctat       480
     ctgcacaccg ccggtagccc caaggcatct agcttgcgcg cggtcgcgac cgacggccac       540
     cggctggcgc agctcgacct gacgctgccg agcggcgccg acggcatgcc gggcttgatc       600
     gtgccgcgca agaccgtggg cgaagtgcag cggctgatcg aagacaccga agccgagatc       660
     ggcatcgaac tgtcgaccgg caagatccgc ttcacgctcg gcaacgtcgt actgacctcc       720
     aagttgatcg acggcacctt cccggactac ggccgggtga tcccgcagaa caacgacaag       780
     gaactgcggg tcgacaagaa ggacttcgaa gccgcggtcg accgcgtttc gacgatctct       840
     tccgaacgcg gccgcgccgt gaaactggcg ctgtcagcag gcaagctggt tctgtcggtg       900
     accaatccag attccggcag cgcgaccgaa gaactcgaag tcgagtacgc gtccgacccg       960
     ctcgatatcg gcttcaactc acgttacctg ctcgacatcg ctgcgcagat cgaaggcgaa      1020
     gtcgccgtgc tcaagctcgc cgaccccggc tcgccgacct tgattcagga ccgcgactcc      1080
     aagagcgcgc tgtacgtcct gatgccgatg cgggtgtag                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page