(data stored in ACNUC30630 zone)

EMBL: CP001096.PE201

CP001096.PE201       Location/Qualifiers
FT   CDS_pept        223170..223343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0203"
FT                   /product="heme exporter protein CcmD"
FT                   /note="TIGRFAM: heme exporter protein CcmD; PFAM: Heme
FT                   exporter protein D (CcmD); KEGG: nha:Nham_0412 heme
FT                   exporter protein D (CcmD)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98763"
FT                   /db_xref="GOA:B3Q775"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q775"
FT                   /protein_id="ACE98763.1"
FT                   /translation="MFGKYADFIVSSYAATAIVVLLLIGWVVLDYRKQKARLRDLEARG
FT                   AVRRSGRSAIDH"
     atgttcggca aatacgcgga cttcatcgtc tcatcctacg ccgcgaccgc gatcgtggtg        60
     ctgctgctga tcggctgggt ggtgctggat tatcgcaagc agaaggcgcg gctgcgcgac       120
     ctcgaagctc gcggcgccgt ccgccgctcc ggccgcagcg ccatcgatca ctaa             174
//

If you have problems or comments...

PBIL Back to PBIL home page