(data stored in ACNUC30630 zone)

EMBL: CP001096.PE205

CP001096.PE205       Location/Qualifiers
FT   CDS_pept        complement(225233..226180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0207"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: bja:bll0473 probable cell division protein;
FT                   TIGRFAM: signal recognition particle-docking protein FtsY;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98767"
FT                   /db_xref="GOA:B3Q779"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q779"
FT                   /protein_id="ACE98767.1"
FT                   /translation="MSDTPENSKQSWWRRLSSGLKRTSSSIGTALSEFVSKRKLDRAML
FT                   EEIEDVLLRADLGTEVAARIAKAVGEGRYDKMISASDVKEIVAAEVEKVLAPVAQPLEV
FT                   DAGNKPFVILMVGVNGSGKTTTIGKLSARFASEGHKVMLAAGDTFRAAAIDQLKVWGDR
FT                   TGTPVVAGAQGSDAAGLAFNALTAAKEQGRDVLLIDTAGRLQNRTELMSELEKVVRVIK
FT                   KVDATAPHAVLLVLDATVGQNALSQVEAFTKTAGVTGLVMTKLDGTARGGILVAIAEKH
FT                   KLPVHFIGVGEGVEDLAPFTARDFAKAIAGTEAA"
     atgagcgaca ctccggaaaa ttcgaaacag agctggtggc gacggctgtc cagcggactg        60
     aagcgcacct cgagctcgat cgggaccgcg ctgtcggaat tcgtctccaa gcgcaagctc       120
     gatcgggcga tgctcgagga gatcgaggac gtgctgctgc gcgccgatct cggcaccgag       180
     gtggcggcgc ggatcgccaa ggcggtcggc gagggccgct acgacaagat gatctcggcc       240
     agcgacgtca aagagatcgt ggccgcggag gtcgagaagg tgctggcgcc ggtggcgcag       300
     ccgctcgagg tcgacgccgg caacaagccg ttcgtgatcc tgatggtcgg ggtcaacggc       360
     tccggcaaga ccaccaccat cggcaaattg tcggcccggt tcgcctccga gggccacaag       420
     gtgatgctgg ccgccggcga caccttccgg gctgcggcga tcgatcagct caaggtctgg       480
     ggcgatcgca ccggcacccc ggtggtcgca ggcgcgcagg gttcggacgc cgcaggcctc       540
     gccttcaacg cactgaccgc ggccaaagag caaggccgtg acgtgctgct gatcgatacc       600
     gccggtcggc tgcagaaccg cacagaactg atgagcgagc tcgaaaaggt ggtgcgggtc       660
     atcaagaagg tcgacgccac cgcgccgcat gcggtgctgc tggtgctcga cgccactgtc       720
     ggccagaacg cgctgtcgca ggtcgaggcg ttcaccaaga ccgccggcgt caccggcctg       780
     gtgatgacta agctcgacgg cacggcgcgc ggcggcatcc tggtggcgat cgccgaaaag       840
     cataagctgc cggtgcattt catcggcgtc ggcgagggcg tcgaggatct ggcgccgttc       900
     accgcgcgcg atttcgccaa ggcgatcgcc ggcacggagg cggcatga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page