(data stored in ACNUC30630 zone)

EMBL: CP001096.PE209

CP001096.PE209       Location/Qualifiers
FT   CDS_pept        complement(230478..231398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0211"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bra:BRADO0242
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98771"
FT                   /db_xref="GOA:B3Q783"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q783"
FT                   /protein_id="ACE98771.1"
FT                   /translation="MSDFRGQRREVNENGRIVITEPGRIIVRDPSGQEFIRHNEVDRFR
FT                   YGARDIRTEQIRGGGTRTIVVRPDGTEIINITGDDGQLMRRIRRDRDGREIIIIDNSYG
FT                   PRDRANFYVDLPPPVIRIPRDRYIVDYEDASPELIYETLEAPPVERIERRYTMDEIRYS
FT                   PAVRQRMPSIDLNTINFDLGSWDIPPDQAAKLQAIADGLNRAIQRNPREVFLIEGHTDA
FT                   VGNDTDNLSLSDRRAEAAAALLTQQFGVPAENLTSQGYGEQYLKIQTQAPERQNRRVTI
FT                   RRITPLLNGGQAALPPPPPGVAPPR"
     atgtccgact tccgtggcca gcgccgcgag gtcaacgaga acggccgcat cgttatcacc        60
     gagccgggcc gcatcatcgt gcgcgacccg agcggccagg agttcatccg ccacaacgag       120
     gtggatcgct tccgctacgg cgcgcgcgac atccgtaccg agcagattcg cggcggtggt       180
     acgcgcacga tcgtggtgcg ccccgatggc accgagatca tcaacatcac cggcgacgac       240
     ggccagctga tgcgacggat ccgccgcgac cgggacggcc gcgaaatcat tatcatcgac       300
     aacagctacg gtccgcgcga ccgggccaac ttctacgtcg atctgccgcc gccggtgatc       360
     cggattcccc gcgaccgcta catcgtcgac tacgaggacg cttcgccgga gctgatctac       420
     gaaaccctgg aggcgccgcc ggtcgaacgg atcgagcgtc gctacaccat ggacgagatc       480
     cgctacagcc cggcggtgcg gcagcggatg ccgtcgatcg atctcaacac catcaacttc       540
     gacctgggct cgtgggacat tcccccggat caggccgcga agctgcaggc gattgcggac       600
     ggtctcaacc gggcgatcca gcgtaacccg cgtgaggtgt tcctgatcga aggccacacc       660
     gacgcggtcg gcaacgacac cgacaatctg tcgctgtcgg atcgtcgcgc cgaggcggct       720
     gccgcactgc tcacccagca gttcggggtg ccggccgaga acctgacctc gcagggctat       780
     ggcgagcagt atctgaagat ccagacccag gctccggagc gtcagaaccg ccgcgtcacc       840
     atccggcgca tcacgccgct gctcaacggc ggccaggcag cactgccgcc gcctcctccg       900
     ggcgtggcgc cgccgcgctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page