(data stored in ACNUC30630 zone)

EMBL: CP001096.PE21

CP001096.PE21        Location/Qualifiers
FT   CDS_pept        complement(22326..23246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0021"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: bbt:BBta_0313 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98583"
FT                   /db_xref="GOA:B3Q5V4"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q5V4"
FT                   /protein_id="ACE98583.1"
FT                   /translation="MRILIVGAGAIGGYFGGRLLQLGRDVTFLVRPGRAAELTRDGLVI
FT                   KSPHGDATIQNPPAVQAAALTPDYDLVVLSCKAFDLDDAIASFRGGVSPRTAILPLLNG
FT                   MKHLDVLDTAFGRDRVLGGQCVIAATLDAQRHVVQLAPMSAITFGERDGASSERVAQIA
FT                   VALGGSDFGVNASPVIMQEMWEKWVFLATLAGSTSLMRGAVGEILVAPGGADFMLGVLD
FT                   EITSIAAAAGHPPRPVAVERTRNMLLAEGSTLTASMFRDILAGARIEADHVVGDLIDRA
FT                   DEAKVPVPRLRVIYTHLKTYERRRG"
     atgcggattc taatcgttgg tgccggtgcg atcggcggct atttcggcgg ccggctgttg        60
     cagctcgggc gcgacgtcac gtttctggtg cggcccggcc gtgcggcgga attgacgcgc       120
     gacgggttgg tgatcaagag cccgcacggc gatgcgacga tccagaatcc tccggccgtg       180
     caggctgcgg cgctgacgcc cgactacgat ctggtggtgc tcagttgcaa ggcgttcgat       240
     ctcgacgacg cgattgcctc gttccgcggc ggcgtaagcc cccgcaccgc gatcctgcca       300
     ttgctcaacg gcatgaagca tctcgacgtg ctcgacaccg cgtttggccg cgaccgcgtg       360
     ctcggcggcc aatgcgtgat cgctgcgacg ctcgatgcgc agcgccatgt cgtgcagctc       420
     gctccgatga gcgcgatcac gtttggcgag cgcgatggcg cgtcgtcgga gcgcgtggcg       480
     cagatcgcgg tggcgctcgg cggcagcgac ttcggcgtca acgcatcgcc ggtgatcatg       540
     caggagatgt gggagaagtg ggtgtttctg gcgacgctcg ccggttccac ctcgctaatg       600
     cgcggcgcgg tcggtgagat cctggtggcg cccggcgggg ccgacttcat gctcggcgtg       660
     ctcgacgaga tcacctcgat cgcggcagcg gcgggccatc ccccgcgtcc ggtggctgtt       720
     gaacgcactc gcaacatgct tctcgccgaa ggctcgacgc tgaccgcgtc gatgttccgc       780
     gacatcctgg cgggcgccag aatcgaagcc gatcatgtgg tcggcgatct gattgatcga       840
     gccgacgaag ccaaggttcc agtgccgcgg cttcgggtga tttacaccca tctgaagacc       900
     tacgaacggc gtcgcggctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page