(data stored in ACNUC30630 zone)

EMBL: CP001096.PE223

CP001096.PE223       Location/Qualifiers
FT   CDS_pept        complement(243816..245003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0225"
FT                   /product="protein of unknown function DUF1228"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: bja:blr0503
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98785"
FT                   /db_xref="GOA:B3Q836"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q836"
FT                   /protein_id="ACE98785.1"
FT                   /translation="MTLLDRTEAAPAHPARLILILSLAPTVGLGIGRFAYSLLLPDMRD
FT                   SLGWSYSAAGFMNTINAAGYLVGALVTSRLVARFGMAAIVRVGTLACVASLALCALSGN
FT                   FAVLSAARLIAGIGAALAFVAGGALATTIAQAQPARSAFLLSLFYAGPGIGILSSGLIA
FT                   PFLLQAAGPGSWWLGWLVLAALSAAMTLPVLLAPIGVDGGLGGGRAAPFRIAPVLVYLA
FT                   GYFMFGAGYIAYMTFMIAYVRDAGGGAAAQSAFWCLIGISAFVTPWVWRRVMALHRGGL
FT                   STTIILAVNAVGAVLPLFSLSPVMLATSALVFGVSFFAVVASTTAFVRFNYPQAGWPGA
FT                   IAAMTIAFGIGQTLGPLVVGAITDAIGSLSSALAVSAATLALGAALSAFQRPLPK"
     ttgaccctgc tcgaccgcac cgaggcggcg cccgctcacc ccgcgcgcct gatcctgatc        60
     ctgtcgcttg cgccgaccgt cgggctcggg attggccgct tcgcctattc gctgctgctg       120
     ccggatatgc gcgacagcct cggctggtcg tattcggcgg ccggattcat gaacaccatc       180
     aatgcggcgg gctatctggt cggcgcgctg gtgacgtccc ggctggtcgc ccggttcggc       240
     atggcggcga tcgtgcgggt tggcacgctg gcctgcgtcg cctcgttggc gctatgcgcg       300
     ctgtcgggca atttcgccgt cctgtcggcg gcccggctga ttgccgggat cggcgcggcg       360
     ctggcgttcg tggccggcgg ggcgctcgcc accacgatcg cccaggcgca gccggcgcgg       420
     tcggcatttc tgctcagcct gttctatgcc ggccccggca tcggcatcct gtcgtcgggg       480
     ctgatcgcgc cgtttctgct gcaggcggcc ggccccggct cgtggtggct tggctggctg       540
     gtgctggcgg cgctgtcggc cgcgatgacc ctaccggtgc tgctggcgcc gatcggggtc       600
     gatggcgggc tcggcggcgg ccgcgcagcg ccgttccgga ttgcccccgt gctggtttat       660
     ctcgccggct acttcatgtt cggtgccggc tacatcgcct acatgacgtt catgatcgcc       720
     tatgtgcgcg atgccggcgg cggtgccgcg gcgcagagcg cgttctggtg tctgatcggg       780
     atcagcgcct tcgtcacccc ctgggtctgg cgccgggtga tggcgctgca ccgcggcggg       840
     ctgtcgacca ccatcatcct ggcggtcaat gcggtcggcg cggtgttgcc gctgttcagc       900
     ctgtcgcccg tgatgctggc gacctcggcg ctggtgttcg gggtgtcgtt cttcgcggtg       960
     gtggcctcga ccaccgcctt cgtccgcttc aactatccgc aggccggctg gcccggtgcg      1020
     atcgccgcaa tgaccatcgc gttcggcatc ggccagacgc tcggcccgct ggtggttggt      1080
     gccatcaccg acgctatcgg ctcgctgtct tccgcgctcg ccgtctccgc cgcgacgctg      1140
     gcactcggcg cggcgctgtc ggcgttccaa cgaccgctgc ctaagtag                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page