(data stored in ACNUC30630 zone)

EMBL: CP001096.PE226

CP001096.PE226       Location/Qualifiers
FT   CDS_pept        complement(247039..247848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98788"
FT                   /db_xref="GOA:B3Q839"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q839"
FT                   /protein_id="ACE98788.1"
FT                   /translation="MRSSPALRAAASRHRIYPALQSFAEECRDTLLRTMAYVGALALIG
FT                   LIVFYTANPLTDAAITAATTAEAGPGWSVATRSQPAYALNQLDWPGKTETTEILRHPDG
FT                   GRKDILRLAAPGEPVAAEIEIYRIGRETSRVAAEAALAARMDPAGTATIETAGVIDTKF
FT                   GPVPLFSLTGSDRPAGSCLGFVKAIDAASLRISGFSCRGDSGPQRRTAVACLLDRLVLL
FT                   SGDAATAAAFAQAELRRGSCAPNQSAASAASADWITGLQDPLLRGRL"
     atgcgaagca gccctgccct ccgcgccgca gcctcccggc accggattta tccggcgctg        60
     cagagcttcg ccgaggaatg tcgtgacacc ctgcttcgga cgatggccta tgtgggcgcg       120
     ctggcgctga tcggcctcat cgtattctac accgccaatc cgctgaccga cgccgcgatc       180
     accgcggcga ccaccgccga ggccggaccg ggctggagcg tggcgacgcg gtcgcaaccg       240
     gcctacgcgc tcaatcagct cgattggccg ggcaagaccg agacgaccga aattctgcgc       300
     caccccgatg gcggccgcaa agacatcctg cgcttggctg cgccgggcga gccggtagcg       360
     gccgagatcg agatctaccg gatcggtcgt gagacctccc gtgtcgcggc agaagcggcc       420
     ctggcggccc ggatggaccc ggctggaaca gcgacgatcg agaccgccgg ggtgatcgat       480
     accaagttcg gcccggtgcc gctgttcagc ctcacgggga gcgatcggcc ggccggttct       540
     tgtctgggct tcgtcaaagc gatcgatgcc gcgagcttga ggatttccgg tttctcctgc       600
     cgcggcgaca gcgggccgca gcgccggacc gcggtggctt gcctgctcga ccggctggtg       660
     ctgctgagcg gcgatgcggc gacggctgcg gcgttcgccc aggccgagct gcggcgcggc       720
     agctgtgcgc cgaatcagtc cgcggcttca gcagcgtcgg ccgactggat caccggcctg       780
     caggaccctt tgctgcgcgg ccggctatga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page