(data stored in ACNUC30630 zone)

EMBL: CP001096.PE228

CP001096.PE228       Location/Qualifiers
FT   CDS_pept        249133..249687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bra:BRADO0359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98790"
FT                   /db_xref="GOA:B3Q841"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q841"
FT                   /protein_id="ACE98790.1"
FT                   /translation="MTDQPDPTPSPSSAKHVERGFETLLFNSRWLMAPFYFGLVISLVV
FT                   LLYKFVMLLYEFIVHATLAKESDIILGVLSLIDVSLTGNLVLIVVFSGYENFVSRIDPG
FT                   NHPDWPEWMTKVDFAGLKQKLLASIVAISAIQVLKAFMNIDSYDQTKLAWLVGIHLVFV
FT                   VSTLIMALSDRWGHSDDKGGH"
     atgacagacc aacctgatcc gacgccatcc ccgtcctccg cgaaacacgt cgagcgcggc        60
     ttcgagacct tgctgttcaa cagccgctgg ctgatggcgc cgttctattt cggtctggtg       120
     atcagcctcg tcgtgctgct ctataaattc gtgatgctgc tgtacgagtt catcgtgcac       180
     gcgacgctcg ccaaggaatc cgacatcatc ctcggcgtgc tcagcctgat cgacgtgtcg       240
     ctgaccggca atctggtgct gatcgtagtg ttctccggct acgagaactt cgtgtcgcgg       300
     atcgaccccg gcaatcatcc ggattggccg gaatggatga ccaaggtcga tttcgccgga       360
     ctgaagcaga agctgctggc ctcgatcgtg gcaatctcgg cgatccaggt gctcaaagcg       420
     ttcatgaaca tcgacagcta cgatcagacc aaactcgcct ggctggtcgg catccatctg       480
     gtgttcgtgg tctcgaccct gatcatggcg ctgtccgacc gctggggcca cagcgacgat       540
     aaaggcggac attag                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page