(data stored in ACNUC30630 zone)

EMBL: CP001096.PE245

CP001096.PE245       Location/Qualifiers
FT   CDS_pept        263657..263926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0247"
FT                   /product="prevent-host-death family protein"
FT                   /note="KEGG: sus:Acid_1771 prevent-host-death family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98807"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q858"
FT                   /protein_id="ACE98807.1"
FT                   /translation="MKFVKLADARAAIEQLLDEVERGETIIITRGVLPRRKAGAPQEQW
FT                   RTAMQDLRDLKKGAGLASIEDLLQWREEQRKAARGQRTAPARWI"
     atgaaattcg tgaagcttgc agatgcccgc gctgcgatcg agcagctgct cgacgaggtc        60
     gaacgcggcg agaccatcat catcacccgt ggcgtcctgc cccgccgcaa agccggcgcg       120
     ccgcaggagc aatggcgaac cgcgatgcag gacctacggg acctgaagaa gggcgccggc       180
     ctcgcctcga tcgaagatct gctgcaatgg cgagaggaac agcgaaaggc agcccgcggc       240
     caacgaacgg cgccggcgag gtggatctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page