(data stored in ACNUC30630 zone)

EMBL: CP001096.PE248

CP001096.PE248       Location/Qualifiers
FT   CDS_pept        complement(265918..266700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0250"
FT                   /product="transcription activator effector binding"
FT                   /note="PFAM: transcription activator effector binding;
FT                   KEGG: bja:blr0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98810"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q861"
FT                   /protein_id="ACE98810.1"
FT                   /translation="MERPCLFGLMRVGLMPALVLTLGIVGASAQTAPYASKDAKDKPPA
FT                   AAPEQAQTPAAPATSATPAAPAPATPPAASEAPAATPVPTTPSAPSATQTPAAPSAPAP
FT                   VQTADPFGEESTLEPKTVVILKGKANWDNAFDSLMDAFKSLTALLDKQGIAPNGNPMIV
FT                   YTSTDDAGFTFQAQIPVPQEPKNLGKSMSIGKSPDGKALKFVHRGSYDNMDNTYEAITN
FT                   FLDDKKLEAKDTFIEEYMTDPLKTAEDKLVINVYVPMK"
     atggaacgcc cctgcctgtt tggtcttatg cgtgtcgggc tgatgccggc gctggtgctg        60
     acgctcggaa tcgtcggcgc atcggcccag accgccccct atgccagcaa ggacgccaag       120
     gacaagccgc cggccgcagc accggagcaa gctcagacgc cggcggcgcc tgccacgtcc       180
     gcaactccgg cggcccccgc ccctgccacg ccgccggccg cgagcgaagc gccggccgcg       240
     acgcctgttc ccaccacgcc gtcggctccg tcagcgaccc agaccccggc ggcgccgtcc       300
     gctcccgcgc cggtgcagac cgccgatccg ttcggcgaag agagcacgct tgagccgaag       360
     acggtggtga tcctgaaggg caaggcgaac tgggacaacg ccttcgacag cctgatggac       420
     gcgttcaagt cgctgaccgc gctgctcgac aagcagggca tcgcgccgaa cggcaacccg       480
     atgatcgttt acacctcgac cgacgacgcc ggcttcactt tccaggcgca aatcccggtg       540
     ccgcaggaac cgaagaacct cggcaagtcg atgagcatcg gcaagtcgcc cgacggcaag       600
     gcgctaaaat tcgtccaccg cggctcctac gacaacatgg acaacaccta cgaggcgatc       660
     accaacttcc tcgacgacaa gaagctcgag gccaaggata ccttcatcga ggaatacatg       720
     accgacccgc tgaagaccgc cgaagacaag ctggtgatca acgtttacgt gccgatgaaa       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page