(data stored in ACNUC30630 zone)

EMBL: CP001096.PE267

CP001096.PE267       Location/Qualifiers
FT   CDS_pept        289185..289862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpal_0269"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; KEGG:
FT                   bja:blr0595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpal_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACE98829"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B3Q880"
FT                   /protein_id="ACE98829.1"
FT                   /translation="MPINAAYRGPADLPEVIPVFPLAGALLLPRGQMPLNIFEPRYLAM
FT                   IDDALRDGHRLIGMIQPDAAHSSETAEKPSLFNVGCVGRITQLAESGDGRYILELTGVS
FT                   RFKVVDELQVLTPYRQCKVDYFPFVDDFTARKGEDEVDRETLLSVLTDFLKANNLKVDW
FT                   DGVESAPNEALVNALAMMSPYGAPEKQALLEAPDLKTRAEILIAVTEMDLAKKRTSGDP
FT                   PLQ"
     atgccgatca atgccgccta tcgcgggcca gccgaccttc ccgaggtgat tccggtattt        60
     ccgctcgccg gggcgctgct gctgccgcgc ggccagatgc cgctgaatat ctttgagccg       120
     cgctatctgg cgatgatcga cgatgcgttg cgcgacggcc atcggctgat cggcatgatc       180
     cagccggatg cggcgcattc gtcggagacc gccgagaagc catcactgtt caacgtcggc       240
     tgcgtcgggc gcatcaccca gctcgccgaa tccggcgacg gccgatacat cctcgaactg       300
     accggtgtgt cgcgcttcaa ggtagtcgat gagctgcagg ttctgacgcc gtaccggcag       360
     tgcaaagtcg actatttccc gttcgtcgac gattttaccg cccgcaaggg cgaggacgag       420
     gttgaccgcg agaccctgct gtcagtgctg accgatttcc tcaaggccaa caatctcaag       480
     gtcgattggg acggcgtcga aagcgcgccg aacgaggctc tggtcaacgc gctagcgatg       540
     atgtcgccat acggagcccc ggagaagcag gcgctgctcg aggcgccgga tctgaaaacg       600
     cgggcggaaa tcctgatcgc cgtcaccgag atggacctcg ccaagaagcg caccagcgga       660
     gacccgccgc tgcaataa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page